Clone GH20835 Report

Search the DGRC for GH20835

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:208
Well:35
Vector:pOT2
Associated Gene/TranscriptCG34439-RA
Protein status:GH20835.pep: gold
Sequenced Size:442

Clone Sequence Records

GH20835.complete Sequence

442 bp assembled on 2009-01-20

GenBank Submission: BT058009.1

> GH20835.complete
ATTGGAACGGACTATCCACGGTCACACTGGGTGTCGTCTTGCAGTAAATA
TCATAACAATCTATTTCCATTGACAATATGTGGTTCGAAATCCTACCTGG
TGCGGTGATCATCACCACGCTCCTCTCGGTGCCCATATACGCCATGTACG
GCCTGGACAAGCTGATGATCGGCAATGCTTTCCGGCGCAACATGGACGAG
CGTTTCAGCCGAGTTATGTACCAGCGCGATTTCCGACTGACCGACAATCC
CTACAAGATGAACGGTCTGGATGCCATACCGGATGAGAAAACGAACTAAT
TTTAATTAAGTAAAGTTTTCCGTTTAAGCTTAAGTGCAAAAGTGAATAAA
CGAAACGTGCAGTTCGGAAGTGATAGTTGAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH20835.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34439-RA 694 CG34439-RA 90..471 1..382 1910 100 Plus
CG34439-RB 781 CG34439-RB 59..326 1..268 1340 100 Plus
TppII-RD 4644 TppII-RD 36..123 264..177 440 100 Minus
TppII-RD 4644 TppII-RD 293..373 177..97 405 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9046006..9046182 1..177 870 99.4 Plus
chr2R 21145070 chr2R 9046869..9046984 264..379 580 100 Plus
chr2R 21145070 chr2R 9046352..9046439 177..264 440 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:01:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13158671..13158847 1..177 885 100 Plus
2R 25286936 2R 13159534..13159652 264..382 595 100 Plus
2R 25286936 2R 13159017..13159104 177..264 440 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13159870..13160046 1..177 885 100 Plus
2R 25260384 2R 13160733..13160851 264..382 595 100 Plus
2R 25260384 2R 13160216..13160303 177..264 440 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:12:18 has no hits.

GH20835.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:13:23 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9046006..9046181 1..176 99 -> Plus
chr2R 9046352..9046438 177..263 100 -> Plus
chr2R 9046869..9046984 264..379 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:39 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
CG34439-RA 1..222 78..299 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:28:48 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
CG34439-RA 1..222 78..299 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:46:35 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
CG34439-RA 1..222 78..299 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:33:14 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
CG34439-RA 1..222 78..299 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-20 18:37:57 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
CG34439-RA 59..437 1..379 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:28:48 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
CG34439-RA 59..437 1..379 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:35 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
CG34439-RA 6..384 1..379 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:33:14 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
CG34439-RA 6..384 1..379 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:23 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13158671..13158846 1..176 100 -> Plus
2R 13159017..13159103 177..263 100 -> Plus
2R 13159534..13159649 264..379 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:23 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13158671..13158846 1..176 100 -> Plus
2R 13159017..13159103 177..263 100 -> Plus
2R 13159534..13159649 264..379 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:23 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13158671..13158846 1..176 100 -> Plus
2R 13159017..13159103 177..263 100 -> Plus
2R 13159534..13159649 264..379 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:35 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9046176..9046351 1..176 100 -> Plus
arm_2R 9046522..9046608 177..263 100 -> Plus
arm_2R 9047039..9047154 264..379 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:01:36 Download gff for GH20835.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13159870..13160045 1..176 100 -> Plus
2R 13160216..13160302 177..263 100 -> Plus
2R 13160733..13160848 264..379 100   Plus

GH20835.hyp Sequence

Translation from 77 to 298

> GH20835.hyp
MWFEILPGAVIITTLLSVPIYAMYGLDKLMIGNAFRRNMDERFSRVMYQR
DFRLTDNPYKMNGLDAIPDEKTN*

GH20835.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34439-PA 73 CG34439-PA 1..73 1..73 384 100 Plus
CG34439-PB 123 CG34439-PB 1..71 1..71 360 95.8 Plus

GH20835.pep Sequence

Translation from 77 to 298

> GH20835.pep
MWFEILPGAVIITTLLSVPIYAMYGLDKLMIGNAFRRNMDERFSRVMYQR
DFRLTDNPYKMNGLDAIPDEKTN*

GH20835.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
ND-MWFE-PA 73 CG34439-PA 1..73 1..73 384 100 Plus
ND-MWFE-PB 123 CG34439-PB 1..71 1..71 360 95.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19985-PA 73 GI19985-PA 1..70 1..70 311 81.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11235-PA 73 GL11235-PA 1..71 1..71 342 90.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24655-PA 73 GA24655-PA 1..71 1..71 342 90.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21680-PA 774 GK21680-PA 1..70 1..70 334 82.9 Plus