GH20835.complete Sequence
442 bp assembled on 2009-01-20
GenBank Submission: BT058009.1
> GH20835.complete
ATTGGAACGGACTATCCACGGTCACACTGGGTGTCGTCTTGCAGTAAATA
TCATAACAATCTATTTCCATTGACAATATGTGGTTCGAAATCCTACCTGG
TGCGGTGATCATCACCACGCTCCTCTCGGTGCCCATATACGCCATGTACG
GCCTGGACAAGCTGATGATCGGCAATGCTTTCCGGCGCAACATGGACGAG
CGTTTCAGCCGAGTTATGTACCAGCGCGATTTCCGACTGACCGACAATCC
CTACAAGATGAACGGTCTGGATGCCATACCGGATGAGAAAACGAACTAAT
TTTAATTAAGTAAAGTTTTCCGTTTAAGCTTAAGTGCAAAAGTGAATAAA
CGAAACGTGCAGTTCGGAAGTGATAGTTGAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
GH20835.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:19:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34439-RA | 694 | CG34439-RA | 90..471 | 1..382 | 1910 | 100 | Plus |
CG34439-RB | 781 | CG34439-RB | 59..326 | 1..268 | 1340 | 100 | Plus |
TppII-RD | 4644 | TppII-RD | 36..123 | 264..177 | 440 | 100 | Minus |
TppII-RD | 4644 | TppII-RD | 293..373 | 177..97 | 405 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:12:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 9046006..9046182 | 1..177 | 870 | 99.4 | Plus |
chr2R | 21145070 | chr2R | 9046869..9046984 | 264..379 | 580 | 100 | Plus |
chr2R | 21145070 | chr2R | 9046352..9046439 | 177..264 | 440 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:01:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:12:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 13158671..13158847 | 1..177 | 885 | 100 | Plus |
2R | 25286936 | 2R | 13159534..13159652 | 264..382 | 595 | 100 | Plus |
2R | 25286936 | 2R | 13159017..13159104 | 177..264 | 440 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 13159870..13160046 | 1..177 | 885 | 100 | Plus |
2R | 25260384 | 2R | 13160733..13160851 | 264..382 | 595 | 100 | Plus |
2R | 25260384 | 2R | 13160216..13160303 | 177..264 | 440 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 18:12:18 has no hits.
GH20835.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:13:23 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 9046006..9046181 | 1..176 | 99 | -> | Plus |
chr2R | 9046352..9046438 | 177..263 | 100 | -> | Plus |
chr2R | 9046869..9046984 | 264..379 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:39 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34439-RA | 1..222 | 78..299 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:28:48 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34439-RA | 1..222 | 78..299 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:46:35 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34439-RA | 1..222 | 78..299 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:33:14 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34439-RA | 1..222 | 78..299 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-20 18:37:57 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34439-RA | 59..437 | 1..379 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:28:48 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34439-RA | 59..437 | 1..379 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:35 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34439-RA | 6..384 | 1..379 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:33:14 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34439-RA | 6..384 | 1..379 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:23 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 13158671..13158846 | 1..176 | 100 | -> | Plus |
2R | 13159017..13159103 | 177..263 | 100 | -> | Plus |
2R | 13159534..13159649 | 264..379 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:23 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 13158671..13158846 | 1..176 | 100 | -> | Plus |
2R | 13159017..13159103 | 177..263 | 100 | -> | Plus |
2R | 13159534..13159649 | 264..379 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:23 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 13158671..13158846 | 1..176 | 100 | -> | Plus |
2R | 13159017..13159103 | 177..263 | 100 | -> | Plus |
2R | 13159534..13159649 | 264..379 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:35 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 9046176..9046351 | 1..176 | 100 | -> | Plus |
arm_2R | 9046522..9046608 | 177..263 | 100 | -> | Plus |
arm_2R | 9047039..9047154 | 264..379 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:01:36 Download gff for
GH20835.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 13159870..13160045 | 1..176 | 100 | -> | Plus |
2R | 13160216..13160302 | 177..263 | 100 | -> | Plus |
2R | 13160733..13160848 | 264..379 | 100 | | Plus |
GH20835.hyp Sequence
Translation from 77 to 298
> GH20835.hyp
MWFEILPGAVIITTLLSVPIYAMYGLDKLMIGNAFRRNMDERFSRVMYQR
DFRLTDNPYKMNGLDAIPDEKTN*
GH20835.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:30:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34439-PA | 73 | CG34439-PA | 1..73 | 1..73 | 384 | 100 | Plus |
CG34439-PB | 123 | CG34439-PB | 1..71 | 1..71 | 360 | 95.8 | Plus |
GH20835.pep Sequence
Translation from 77 to 298
> GH20835.pep
MWFEILPGAVIITTLLSVPIYAMYGLDKLMIGNAFRRNMDERFSRVMYQR
DFRLTDNPYKMNGLDAIPDEKTN*
GH20835.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ND-MWFE-PA | 73 | CG34439-PA | 1..73 | 1..73 | 384 | 100 | Plus |
ND-MWFE-PB | 123 | CG34439-PB | 1..71 | 1..71 | 360 | 95.8 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:08:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI19985-PA | 73 | GI19985-PA | 1..70 | 1..70 | 311 | 81.4 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:08:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL11235-PA | 73 | GL11235-PA | 1..71 | 1..71 | 342 | 90.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:08:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA24655-PA | 73 | GA24655-PA | 1..71 | 1..71 | 342 | 90.1 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:08:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK21680-PA | 774 | GK21680-PA | 1..70 | 1..70 | 334 | 82.9 | Plus |