Clone GH20858 Report

Search the DGRC for GH20858

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:208
Well:58
Vector:pOT2
Associated Gene/TranscriptCG9099-RA
Protein status:GH20858.pep: gold
Preliminary Size:904
Sequenced Size:732

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9099 2001-01-01 Release 2 assignment
CG9099 2001-10-10 Blastp of sequenced clone
CG9099 2003-01-01 Sim4 clustering to Release 3
CG9099 2008-04-29 Release 5.5 accounting
CG9099 2008-08-15 Release 5.9 accounting
CG9099 2008-12-18 5.12 accounting

Clone Sequence Records

GH20858.complete Sequence

732 bp (732 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060757

> GH20858.complete
TCTTAAAACTGTCATTATTTTAATATTTCAATAACCCGGAGCAAATCCCA
GGCAGTTAATCCGATCCGCAATGACGAACGAAGATGTGGGCACCAACAGC
GTCGCCGACCGCCTACAGTTGGGTCCGCGCGAAGGCGTCACCTATCCGAT
CCAGATGAAGTACTGTGGCCACTGCACGATGCCCATTGAGTACTGCGAGT
ACTATCCGGAGTACGAGAAGTGCAAGGAGTGGCTGGAGCTCCACATGCCC
GATGACTTCGAGCGACTAAAGATTGAGGAGGAGGCTGCCGCCGCTGACGG
GACGGATGACGACAAGAAGCGCCAGAAACGCGGTGGCAAGGGACTGTTGC
GCGTCAAGAAGAAAGAGGACGTGCCCAAGCGTATCTGCGTCTCGCGGGCG
GCACGTGGCAAAAAGAAGTCAGTGACCGTGGTCACAGGATTGAGCACTTT
TGATATTGATCTCAAGGTGGCCGCCAAGTTCTTTGGCACGAAATTTGCCT
GCGGCTCCTCGGTTACCGGAGACGACGAGATCGTCATTCAGGGTGACGTC
AAGGATGACTTGTTCGATGTCATACCCGAAAAATGGGCCGAGATCGATGA
GGACGTCATCGAGGATTTGGGCGATCAGAAGCGAACATAAATAATTTACC
TTTTTTTTTAGCTTATTTTATACGCTCCATCAACATAAATATATGAAACG
TTAAACGTAAAAAAAAAAAAAAAAAAAAAAAA

GH20858.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9099-RA 832 CG9099-RA 119..828 1..710 3550 100 Plus
CG9099.a 726 CG9099.a 69..726 51..708 3290 100 Plus
CG9099.b 587 CG9099.b 40..491 1..452 2260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16775594..16775857 452..189 1320 100 Minus
chrX 22417052 chrX 16775173..16775429 708..452 1285 100 Minus
chrX 22417052 chrX 16775945..16776134 190..1 935 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:01:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16885967..16886230 452..189 1320 100 Minus
X 23542271 X 16885544..16885802 710..452 1295 100 Minus
X 23542271 X 16886318..16886507 190..1 950 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16894065..16894328 452..189 1320 100 Minus
X 23527363 X 16893642..16893900 710..452 1295 100 Minus
X 23527363 X 16894416..16894605 190..1 950 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:54:34 has no hits.

GH20858.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:55:23 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16775173..16775428 453..708 100 <- Minus
chrX 16775594..16775855 191..452 100 <- Minus
chrX 16775945..16776134 1..190 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:50:48 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
CG9099-RA 1..570 71..640 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:57:52 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
CG9099-RA 1..570 71..640 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:34:28 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
CG9099-RA 1..570 71..640 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:40:54 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
CG9099-RA 1..570 71..640 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:45:27 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
CG9099-RA 1..570 71..640 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:12:08 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
CG9099-RA 19..724 1..706 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:57:52 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
CG9099-RA 19..724 1..706 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:34:28 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
CG9099-RA 22..729 1..708 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:40:54 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
CG9099-RA 19..724 1..706 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:45:27 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
CG9099-RA 22..729 1..708 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:23 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
X 16885967..16886228 191..452 100 <- Minus
X 16886318..16886507 1..190 100   Minus
X 16885546..16885801 453..708 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:23 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
X 16885967..16886228 191..452 100 <- Minus
X 16886318..16886507 1..190 100   Minus
X 16885546..16885801 453..708 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:23 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
X 16885967..16886228 191..452 100 <- Minus
X 16886318..16886507 1..190 100   Minus
X 16885546..16885801 453..708 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:34:28 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16779579..16779834 453..708 100 <- Minus
arm_X 16780000..16780261 191..452 100 <- Minus
arm_X 16780351..16780540 1..190 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:24:02 Download gff for GH20858.complete
Subject Subject Range Query Range Percent Splice Strand
X 16893644..16893899 453..708 100 <- Minus
X 16894065..16894326 191..452 100 <- Minus
X 16894416..16894605 1..190 100   Minus

GH20858.pep Sequence

Translation from 70 to 639

> GH20858.pep
MTNEDVGTNSVADRLQLGPREGVTYPIQMKYCGHCTMPIEYCEYYPEYEK
CKEWLELHMPDDFERLKIEEEAAAADGTDDDKKRQKRGGKGLLRVKKKED
VPKRICVSRAARGKKKSVTVVTGLSTFDIDLKVAAKFFGTKFACGSSVTG
DDEIVIQGDVKDDLFDVIPEKWAEIDEDVIEDLGDQKRT*

GH20858.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21753-PA 132 GF21753-PA 1..127 1..127 559 91.3 Plus
Dana\GF19734-PA 56 GF19734-PA 4..56 136..188 241 88.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18216-PA 189 GG18216-PA 1..189 1..189 976 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12791-PA 185 GH12791-PA 1..185 1..188 806 89.9 Plus
Dgri\GH18123-PA 188 GH18123-PA 14..184 25..189 555 60.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
DENR-PB 189 CG9099-PB 1..189 1..189 1004 100 Plus
DENR-PA 189 CG9099-PA 1..189 1..189 1004 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15232-PA 185 GI15232-PA 1..185 1..188 890 91.5 Plus
Dmoj\GI23839-PA 195 GI23839-PA 23..195 23..188 547 62.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22388-PA 189 GL22388-PA 1..189 1..188 820 89.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21541-PA 189 GA21541-PA 1..189 1..188 820 89.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13357-PA 189 GM13357-PA 1..189 1..189 982 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15715-PA 189 GD15715-PA 1..189 1..189 982 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18691-PA 185 GJ18691-PA 1..185 1..188 890 91 Plus
Dvir\GJ23296-PA 196 GJ23296-PA 23..192 23..188 581 65.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14620-PA 187 GK14620-PA 1..187 1..188 905 92.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15635-PA 189 GE15635-PA 1..189 1..189 976 98.4 Plus

GH20858.hyp Sequence

Translation from 70 to 639

> GH20858.hyp
MTNEDVGTNSVADRLQLGPREGVTYPIQMKYCGHCTMPIEYCEYYPEYEK
CKEWLELHMPDDFERLKIEEEAAAADGTDDDKKRQKRGGKGLLRVKKKED
VPKRICVSRAARGKKKSVTVVTGLSTFDIDLKVAAKFFGTKFACGSSVTG
DDEIVIQGDVKDDLFDVIPEKWAEIDEDVIEDLGDQKRT*

GH20858.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG9099-PB 189 CG9099-PB 1..189 1..189 1004 100 Plus
CG9099-PA 189 CG9099-PA 1..189 1..189 1004 100 Plus