Clone GH20904 Report

Search the DGRC for GH20904

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:209
Well:4
Vector:pOT2
Associated Gene/TranscriptCpr50Cb-RA
Protein status:GH20904.pep: gold
Preliminary Size:1036
Sequenced Size:859

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6305 2001-01-01 Release 2 assignment
CG6305 2001-10-10 Blastp of sequenced clone
CG6305 2003-01-01 Sim4 clustering to Release 3
Cpr50Cb 2008-04-29 Release 5.5 accounting
Cpr50Cb 2008-08-15 Release 5.9 accounting
Cpr50Cb 2008-12-18 5.12 accounting

Clone Sequence Records

GH20904.complete Sequence

859 bp (859 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060758

> GH20904.complete
CTTCGTGCGGTTGTCTAGGAAATCAATCTAGCCGAACCTAAAAAGATAAA
ACCACCTCCTCTTTAACTGAGGCCCCCTCCTAGTTGAGAAATCCAACCGG
TGATAAAAAAATAAAACCCTCCCCCGCCCGGTGAAACCAGCGGCGTTTGT
GGATACACTACTTTTTGCCATCGTCTGTGAACGTAAAATCGAAACTCAAC
TAACAAAATGATGTCCTTCAAGTCGTTCGTCCTGCTTAGCTTATCCCTCG
CTGCCATCAGTGCCTATGCCTACGCCCAGATCGCCCCTGGCTCCAACGCG
TACCTCCCGCCCACCAAGAATGGCTACGACTACTCGGAACCCAAGACCCC
ATTCAAGCCCGGCCCACCTGGAAGACCAGCGGCACCTGGACCCCGGCCAC
CCGCACCTCCTGGCACTCCCCGCAACATACCTGGCCAGCCAGGCGATGAC
CATGTCCACGTGCCCGGCATGCCGTACGACTTCGAGTACGCCGTTCAGGA
TCCGGAGACCGCCAACGATTATGCGCACAAGGCGTCCAGTGATGGTGACG
TGGTGACCGGCGAGTACCGCGTCCAGATGCCCGACGGAAGGACCCAGATC
GTCCGCTACACCGCCGACTGGAAGACGGGCTACCACGCGGACGTGAGCTA
CGAGGGCGAGGCCACGTACCCGCAGGGACCACAGCCAGGAGCTCGTGGCG
GCGGCGGCGGTGGTGCTGGTGGTGCCGGCGGGTACAAGTACTAGGCGTGG
GTGGTGCTTCGACTGGGTCAGCTGGGGTCACATATGTATCTTGCGAAACG
TGTAAGCCTTACGATATACCAATAAAAAGTATTGATAAACTAAAAAAAAA
AAAAAAAAA

GH20904.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr50Cb-RA 1098 Cpr50Cb-RA 22..865 1..844 4220 100 Plus
Cpr50Cb.d 1264 Cpr50Cb.d 324..1031 137..844 3540 100 Plus
Cpr50Cb.b 1033 Cpr50Cb.b 324..1031 137..844 3540 100 Plus
Cpr50Cb.d 1264 Cpr50Cb.d 22..157 1..136 680 100 Plus
Cpr50Cb.b 1033 Cpr50Cb.b 22..157 1..136 680 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9692179..9692566 448..841 1785 97.5 Plus
chr2R 21145070 chr2R 9690968..9691084 238..354 585 100 Plus
chr2R 21145070 chr2R 9682143..9682280 1..136 575 97.8 Plus
chr2R 21145070 chr2R 9682444..9682543 138..237 500 100 Plus
chr2R 21145070 chr2R 9691704..9691797 355..448 470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:01:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13804838..13805234 448..844 1985 100 Plus
2R 25286936 2R 13794803..13794938 1..136 680 100 Plus
2R 25286936 2R 13803625..13803741 238..354 585 100 Plus
2R 25286936 2R 13795105..13795205 137..237 505 100 Plus
2R 25286936 2R 13804363..13804456 355..448 470 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13806037..13806433 448..844 1985 100 Plus
2R 25260384 2R 13796002..13796137 1..136 680 100 Plus
2R 25260384 2R 13804824..13804940 238..354 585 100 Plus
2R 25260384 2R 13796304..13796404 137..237 505 100 Plus
2R 25260384 2R 13805562..13805655 355..448 470 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:17:21 has no hits.

GH20904.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:18:28 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9682143..9682286 1..140 95 -> Plus
chr2R 9682447..9682543 141..237 100 -> Plus
chr2R 9690968..9691084 238..354 100 -> Plus
chr2R 9691704..9691796 355..447 100 -> Plus
chr2R 9692179..9692566 448..841 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:31:34 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr50Cb-RA 1..537 208..744 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:51:20 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr50Cb-RA 1..537 208..744 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:50 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr50Cb-RA 1..537 208..744 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:20:26 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr50Cb-RA 1..537 208..744 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:29:53 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr50Cb-RA 1..537 208..744 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:31:34 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr50Cb-RA 1..841 1..841 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:51:20 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr50Cb-RA 1..841 1..841 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:50 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr50Cb-RA 27..867 1..841 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:20:26 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr50Cb-RA 1..841 1..841 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:29:53 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr50Cb-RA 27..867 1..841 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:28 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13794803..13794938 1..136 100 -> Plus
2R 13795105..13795205 137..237 100 -> Plus
2R 13803625..13803741 238..354 100 -> Plus
2R 13804363..13804455 355..447 100 -> Plus
2R 13804838..13805231 448..841 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:28 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13794803..13794938 1..136 100 -> Plus
2R 13795105..13795205 137..237 100 -> Plus
2R 13803625..13803741 238..354 100 -> Plus
2R 13804363..13804455 355..447 100 -> Plus
2R 13804838..13805231 448..841 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:28 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13794803..13794938 1..136 100 -> Plus
2R 13795105..13795205 137..237 100 -> Plus
2R 13803625..13803741 238..354 100 -> Plus
2R 13804363..13804455 355..447 100 -> Plus
2R 13804838..13805231 448..841 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:50 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9691130..9691246 238..354 100 -> Plus
arm_2R 9691868..9691960 355..447 100 -> Plus
arm_2R 9682308..9682443 1..136 100 -> Plus
arm_2R 9682610..9682710 137..237 100 -> Plus
arm_2R 9692343..9692736 448..841 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:57:08 Download gff for GH20904.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13806037..13806430 448..841 100   Plus
2R 13796002..13796137 1..136 100 -> Plus
2R 13796304..13796404 137..237 100 -> Plus
2R 13804824..13804940 238..354 100 -> Plus
2R 13805562..13805654 355..447 100 -> Plus

GH20904.pep Sequence

Translation from 207 to 743

> GH20904.pep
MMSFKSFVLLSLSLAAISAYAYAQIAPGSNAYLPPTKNGYDYSEPKTPFK
PGPPGRPAAPGPRPPAPPGTPRNIPGQPGDDHVHVPGMPYDFEYAVQDPE
TANDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYEG
EATYPQGPQPGARGGGGGGAGGAGGYKY*

GH20904.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13710-PA 174 GF13710-PA 1..155 1..156 632 85.9 Plus
Dana\GF10053-PA 1377 GF10053-PA 1278..1358 64..146 177 44.7 Plus
Dana\GF12672-PA 213 GF12672-PA 126..184 90..149 161 51.7 Plus
Dana\GF11408-PA 587 GF11408-PA 320..382 90..153 153 45.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20401-PA 181 GG20401-PA 1..181 1..178 884 97.2 Plus
Dere\GG16042-PA 1211 GG16042-PA 1136..1192 90..146 176 54.4 Plus
Dere\GG20868-PA 217 GG20868-PA 128..186 90..149 161 51.7 Plus
Dere\GG20628-PA 619 GG20628-PA 345..407 90..153 153 45.3 Plus
Dere\GG20400-PA 810 GG20400-PA 746..806 90..150 143 51.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21033-PA 173 GH21033-PA 1..155 1..158 626 83.5 Plus
Dgri\GH17180-PA 2075 GH17180-PA 2000..2056 90..146 173 52.6 Plus
Dgri\GH10353-PA 81 GH10353-PA 6..62 90..146 161 52.6 Plus
Dgri\GH23088-PA 605 GH23088-PA 313..375 90..153 153 45.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr50Cb-PA 178 CG6305-PA 1..178 1..178 985 100 Plus
resilin-PA 620 CG15920-PA 272..428 26..176 209 35.4 Plus
Cpr56F-PA 217 CG9036-PA 2..203 5..175 202 30.8 Plus
Cpr76Bd-PD 1228 CG9299-PD 1108..1209 57..146 176 37.3 Plus
Cpr76Bd-PB 1228 CG9299-PB 1108..1209 57..146 176 37.3 Plus
Cpr76Bd-PC 1231 CG9299-PC 1111..1212 57..146 176 37.3 Plus
Cpr50Ca-PA 815 CG13338-PA 751..811 90..150 152 51.6 Plus
Cpr76Bb-PA 198 CG9290-PA 86..182 90..178 141 36.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18634-PA 173 GI18634-PA 27..153 27..156 555 84.6 Plus
Dmoj\GI11793-PA 1160 GI11793-PA 1060..1141 66..146 176 43.9 Plus
Dmoj\GI18779-PA 206 GI18779-PA 117..175 90..149 159 51.7 Plus
Dmoj\GI21153-PA 589 GI21153-PA 299..357 90..149 149 46.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17473-PA 176 GL17473-PA 1..159 1..160 666 88.1 Plus
Dper\GL20939-PA 1339 GL20939-PA 1239..1320 66..146 175 43.9 Plus
Dper\GL16837-PA 227 GL16837-PA 1..192 1..149 165 30.3 Plus
Dper\GL11800-PA 621 GL11800-PA 312..374 90..153 157 46.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19503-PA 176 GA19503-PA 1..159 1..160 666 88.1 Plus
Dpse\GA28637-PA 1341 GA28637-PA 1241..1322 66..146 175 43.9 Plus
Dpse\GA21496-PB 227 GA21496-PB 132..190 90..149 161 51.7 Plus
Dpse\GA24081-PA 621 GA24081-PA 310..372 90..153 157 46.9 Plus
Dpse\GA12217-PA 841 GA12217-PA 777..837 90..150 143 51.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21489-PA 178 GM21489-PA 1..178 1..178 894 98.3 Plus
Dsec\GM19583-PA 1231 GM19583-PA 1156..1212 90..146 176 54.4 Plus
Dsec\GM21722-PA 623 GM21722-PA 345..407 90..153 151 45.3 Plus
Dsec\GM21488-PA 813 GM21488-PA 749..809 90..150 144 51.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10983-PA 178 GD10983-PA 1..178 1..178 902 99.4 Plus
Dsim\GD14810-PA 648 GD14810-PA 573..629 90..146 175 54.4 Plus
Dsim\GD25285-PA 215 GD25285-PA 126..184 90..149 160 51.7 Plus
Dsim\GD11218-PA 609 GD11218-PA 331..393 90..153 151 45.3 Plus
Dsim\GD10982-PA 826 GD10982-PA 762..822 90..150 143 51.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21646-PA 174 GJ21646-PA 1..154 1..156 601 81.4 Plus
Dvir\GJ13496-PA 1359 GJ13496-PA 1284..1340 90..146 173 52.6 Plus
Dvir\GJ21806-PA 229 GJ21806-PA 139..197 90..149 160 51.7 Plus
Dvir\GJ21001-PA 633 GJ21001-PA 358..418 90..151 148 46.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17855-PA 176 GK17855-PA 1..163 1..163 637 83.4 Plus
Dwil\GK20224-PA 1363 GK20224-PA 1265..1343 66..146 169 44.6 Plus
Dwil\GK19531-PA 134 GK19531-PA 42..101 89..149 155 50.8 Plus
Dwil\GK15914-PA 605 GK15914-PA 341..403 90..153 150 45.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12561-PA 180 GE12561-PA 1..180 1..178 889 98.3 Plus
Dyak\GE23208-PA 929 GE23208-PA 809..910 57..146 176 38.2 Plus
Dyak\GE19607-PA 1197 GE19607-PA 1077..1178 57..146 176 38.2 Plus
Dyak\GE13808-PA 215 GE13808-PA 126..184 90..149 161 51.7 Plus
Dyak\GE11818-PA 622 GE11818-PA 337..399 90..153 152 45.3 Plus

GH20904.hyp Sequence

Translation from 207 to 743

> GH20904.hyp
MMSFKSFVLLSLSLAAISAYAYAQIAPGSNAYLPPTKNGYDYSEPKTPFK
PGPPGRPAAPGPRPPAPPGTPRNIPGQPGDDHVHVPGMPYDFEYAVQDPE
TANDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYEG
EATYPQGPQPGARGGGGGGAGGAGGYKY*

GH20904.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr50Cb-PA 178 CG6305-PA 1..178 1..178 985 100 Plus
resilin-PA 620 CG15920-PA 272..428 26..176 209 35.4 Plus
Cpr56F-PA 217 CG9036-PA 2..203 5..175 202 30.8 Plus
Cpr76Bd-PD 1228 CG9299-PD 1108..1209 57..146 176 37.3 Plus
Cpr76Bd-PB 1228 CG9299-PB 1108..1209 57..146 176 37.3 Plus