Clone GH20954 Report

Search the DGRC for GH20954

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:209
Well:54
Vector:pOT2
Associated Gene/TranscriptCG5565-RA
Protein status:GH20954.pep: gold
Preliminary Size:1123
Sequenced Size:960

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5565 2001-01-01 Release 2 assignment
CG5565 2003-02-22 Blastp of sequenced clone
CG5565 2008-04-29 Release 5.5 accounting
CG5565 2008-08-15 Release 5.9 accounting
CG5565 2008-12-18 5.12 accounting

Clone Sequence Records

GH20954.complete Sequence

960 bp (960 high quality bases) assembled on 2003-02-22

GenBank Submission: BT004879

> GH20954.complete
AATTATCTCTCAAAATTCTTAATGAAAATTCAGTAACAGAAGAATCAAAT
TGTTGTAGTTAGTTTTTGGAAAATTAAGCACCGTTCTGGCCAAGGCGAAC
CCTCTAAATTAAGGAGCATGCGGTGTGTGATATGAAGAGCTTAGACCATT
GTAGAAATGCCCACCAAGAAGTGTTACTGCCCCGTCACTCATGTCATCTT
TGACTGCGATGGAACCTTGATAGATAGCGAAGGCATCTACCTCAAAACGG
TTCAAGACTTGTTGGCTAAATATGGCAAAACGTACACCAAAGTCGATCAG
ACGCAGCATATGGGAATGCCGGTCGGTACATTTTCCCAACACATCGTCAA
GGATCTAAAACTTCCGTTGTCACCTGCGGAATTTCAAAAGGAATTCGAGG
CAGCTGTTGATAAGAGCATGGGAAGTGTGGCTCTGCTGCCAGGGGTCAGG
GATCTGATTCTCCACTTGCACGAATACCGCATACCCTTCTGCATAGCCAC
AAGTTCGTTTAGGAAACTGTTCAAAGTGAAGGCCGAGTCCTTCAAGGATA
TATTCCTGGCCTTTCACCACGTTGTCTGTGGCGATGATCCGGCACTTGGA
CCGGGAAGAGGAAAGCCCTACCCAGATATATATCTCCTGGCCGCCTCGCG
ATTCAATCCGCCCGCAGATCCCAAAAAGTGTCTTATATTCGAGGATGCTC
CAGTGGGCCTCATAGGCGGAAAGGCAGCGGGATCCCAAGTCATCTTTATT
CCAACTGATAACGTTTCCAAGCAGCAGAAAAAGGGCGCCACCATGGTTCT
AAAATCGATGGCGGACTTTAAGCCTGAGCTCTTTGGTCTACCACCCTTTG
ACACCTGCTCCAAATTCGAGTTTGGCTAATCCCTAGCACTCTAAATTGAT
CCGTCAAAATTAGTATTCTATCTATAAAATAAAAAATAATTCAAAAAAAA
AAAAAAAAAA

GH20954.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG5565-RA 946 CG5565-RA 5..946 1..942 4710 100 Plus
CG5565.a 1446 CG5565.a 505..1446 1..942 4710 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1354771..1355491 942..222 3575 99.7 Minus
chr2L 23010047 chr2L 1355562..1355785 223..1 1055 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:01:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1354907..1355631 946..222 3625 100 Minus
2L 23513712 2L 1355702..1355924 223..1 1115 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1354907..1355631 946..222 3625 100 Minus
2L 23513712 2L 1355702..1355924 223..1 1115 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:21:15 has no hits.

GH20954.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:22:10 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1354771..1355489 224..942 99 <- Minus
chr2L 1355562..1355785 1..223 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:50:53 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
CG5565-RA 1..723 157..879 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:49:05 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
CG5565-RA 1..723 157..879 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:28 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
CG5565-RA 1..723 157..879 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:27 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
CG5565-RA 1..723 157..879 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:31:56 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
CG5565-RA 1..723 157..879 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:01:39 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
CG5565-RA 1..903 1..903 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:49:04 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
CG5565-RA 1..942 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:28 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
CG5565-RA 1..942 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:27 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
CG5565-RA 1..903 1..903 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:31:56 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
CG5565-RA 1..942 1..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:22:10 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1354911..1355629 224..942 100 <- Minus
2L 1355702..1355924 1..223 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:22:10 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1354911..1355629 224..942 100 <- Minus
2L 1355702..1355924 1..223 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:22:10 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1354911..1355629 224..942 100 <- Minus
2L 1355702..1355924 1..223 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:28 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1355702..1355924 1..223 100   Minus
arm_2L 1354911..1355629 224..942 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:10:51 Download gff for GH20954.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1355702..1355924 1..223 100   Minus
2L 1354911..1355629 224..942 100 <- Minus

GH20954.hyp Sequence

Translation from 156 to 878

> GH20954.hyp
MPTKKCYCPVTHVIFDCDGTLIDSEGIYLKTVQDLLAKYGKTYTKVDQTQ
HMGMPVGTFSQHIVKDLKLPLSPAEFQKEFEAAVDKSMGSVALLPGVRDL
ILHLHEYRIPFCIATSSFRKLFKVKAESFKDIFLAFHHVVCGDDPALGPG
RGKPYPDIYLLAASRFNPPADPKKCLIFEDAPVGLIGGKAAGSQVIFIPT
DNVSKQQKKGATMVLKSMADFKPELFGLPPFDTCSKFEFG*

GH20954.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG5565-PA 240 CG5565-PA 1..240 1..240 1275 100 Plus
Gs1l-PA 231 CG15441-PA 9..229 10..231 461 40.5 Plus
Gs1l-PB 231 CG15441-PB 9..229 10..231 436 37.8 Plus
CG31924-PB 236 CG31924-PB 8..235 3..230 424 41.3 Plus
CG5561-PA 305 CG5561-PA 21..245 5..231 253 28.5 Plus

GH20954.pep Sequence

Translation from 156 to 878

> GH20954.pep
MPTKKCYCPVTHVIFDCDGTLIDSEGIYLKTVQDLLAKYGKTYTKVDQTQ
HMGMPVGTFSQHIVKDLKLPLSPAEFQKEFEAAVDKSMGSVALLPGVRDL
ILHLHEYRIPFCIATSSFRKLFKVKAESFKDIFLAFHHVVCGDDPALGPG
RGKPYPDIYLLAASRFNPPADPKKCLIFEDAPVGLIGGKAAGSQVIFIPT
DNVSKQQKKGATMVLKSMADFKPELFGLPPFDTCSKFEFG*

GH20954.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14724-PA 240 GF14724-PA 1..240 1..240 764 58.3 Plus
Dana\GF14725-PA 240 GF14725-PA 1..240 1..240 753 56.2 Plus
Dana\GF14726-PA 141 GF14726-PA 1..141 100..240 505 66 Plus
Dana\GF19687-PA 241 GF19687-PA 12..239 3..229 433 39.6 Plus
Dana\GF24022-PA 304 GF24022-PA 95..304 23..233 409 37.4 Plus
Dana\GF24022-PA 304 GF24022-PA 3..94 4..95 149 35.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24596-PA 153 GG24596-PA 1..153 88..240 716 88.2 Plus
Dere\GG24597-PA 240 GG24597-PA 12..240 3..231 446 41.6 Plus
Dere\GG24373-PA 304 GG24373-PA 83..302 11..231 385 34.4 Plus
Dere\GG24595-PA 83 GG24595-PA 1..59 1..59 267 83.1 Plus
Dere\GG24600-PA 297 GG24600-PA 27..245 10..231 249 25.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10332-PA 238 GH10332-PA 1..238 1..240 658 54.2 Plus
Dgri\GH11658-PA 304 GH11658-PA 95..304 23..233 396 37 Plus
Dgri\GH11411-PA 303 GH11411-PA 34..245 13..228 243 28.2 Plus
Dgri\GH11658-PA 304 GH11658-PA 3..94 4..95 149 34.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG5565-PA 240 CG5565-PA 1..240 1..240 1275 100 Plus
Gs1l-PA 231 CG15441-PA 9..229 10..231 461 40.5 Plus
Gs1l-PB 231 CG15441-PB 9..229 10..231 436 37.8 Plus
CG31924-PB 236 CG31924-PB 8..235 3..230 424 41.3 Plus
CG5561-PA 305 CG5561-PA 21..245 5..231 253 28.5 Plus
CG5556-PB 299 CG5556-PB 19..245 2..231 233 26.1 Plus
CG5556-PA 299 CG5556-PA 19..245 2..231 233 26.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17090-PA 240 GI17090-PA 8..240 6..240 585 48.5 Plus
Dmoj\GI17960-PA 304 GI17960-PA 95..304 23..233 385 36.5 Plus
Dmoj\GI18114-PA 299 GI18114-PA 38..253 10..229 261 28.6 Plus
Dmoj\GI17960-PA 304 GI17960-PA 3..94 4..95 153 38 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14859-PA 240 GL14859-PA 1..240 1..240 739 55 Plus
Dper\GL15658-PA 240 GL15658-PA 1..240 1..240 738 55 Plus
Dper\GL15404-PA 304 GL15404-PA 95..302 23..231 425 40.7 Plus
Dper\GL15659-PA 236 GL15659-PA 12..236 6..231 405 37.9 Plus
Dper\GL14869-PA 236 GL14869-PA 12..236 6..231 405 37.9 Plus
Dper\GL15404-PA 304 GL15404-PA 3..131 4..128 153 30.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25358-PA 240 GA25358-PA 1..240 1..240 739 55 Plus
Dpse\GA18974-PA 240 GA18974-PA 1..240 1..240 739 55 Plus
Dpse\GA23995-PA 220 GA23995-PA 2..220 22..240 659 54.3 Plus
Dpse\GA13732-PA 304 GA13732-PA 95..302 23..231 425 40.7 Plus
Dpse\GA23996-PA 236 GA23996-PA 12..236 6..231 414 38.3 Plus
Dpse\GA13732-PA 304 GA13732-PA 3..131 4..128 153 30.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16613-PA 240 GM16613-PA 1..240 1..240 1190 94.2 Plus
Dsec\GM18089-PA 304 GM18089-PA 95..302 23..231 383 37 Plus
Dsec\GM16614-PA 216 GM16614-PA 11..216 25..231 366 38.9 Plus
Dsec\GM16615-PA 304 GM16615-PA 27..245 10..231 261 27.9 Plus
Dsec\GM16616-PA 299 GM16616-PA 27..245 10..231 248 25.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22912-PA 240 GD22912-PA 1..240 1..240 1197 95 Plus
Dsim\GD22707-PA 304 GD22707-PA 95..302 23..231 384 36.5 Plus
Dsim\GD22913-PA 216 GD22913-PA 11..216 25..231 365 38.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10810-PA 240 GJ10810-PA 5..240 3..240 655 53.4 Plus
Dvir\GJ17733-PA 304 GJ17733-PA 95..302 23..231 404 37.3 Plus
Dvir\GJ17047-PA 308 GJ17047-PA 40..252 12..228 249 29 Plus
Dvir\GJ17733-PA 304 GJ17733-PA 9..94 10..95 144 38.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15189-PA 240 GK15189-PA 1..240 1..240 667 54.2 Plus
Dwil\GK13331-PA 238 GK13331-PA 15..236 9..231 453 39.9 Plus
Dwil\GK23925-PA 304 GK23925-PA 91..304 19..233 433 40 Plus
Dwil\GK19038-PA 243 GK19038-PA 16..241 6..232 429 39.6 Plus
Dwil\GK14950-PA 294 GK14950-PA 18..244 5..231 224 28.1 Plus
Dwil\GK23925-PA 304 GK23925-PA 3..94 4..95 146 33.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15633-PA 240 GE15633-PA 1..240 1..240 1087 85.4 Plus
Dyak\GE15644-PA 240 GE15644-PA 17..240 7..231 411 39.8 Plus
Dyak\GE14717-PA 304 GE14717-PA 83..302 11..231 390 35.9 Plus
Dyak\GE15655-PA 304 GE15655-PA 27..245 10..231 269 27.9 Plus
Dyak\GE15666-PA 301 GE15666-PA 27..245 10..231 253 26.1 Plus