Clone GH21008 Report

Search the DGRC for GH21008

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:210
Well:8
Vector:pOT2
Associated Gene/TranscriptPGRP-LB-RA
Protein status:GH21008.pep: gold
Preliminary Size:1320
Sequenced Size:1157

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14704 2001-01-01 Release 2 assignment
CG14704 2001-10-10 Blastp of sequenced clone
CG14704 2003-01-01 Sim4 clustering to Release 3
PGRP-LB 2008-04-29 Release 5.5 accounting
PGRP-LB 2008-08-15 Release 5.9 accounting
PGRP-LB 2008-12-18 5.12 accounting

Clone Sequence Records

GH21008.complete Sequence

1157 bp (1157 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060759

> GH21008.complete
TCGTCGGAACCGCAGCCACCGCCGCCGCTGAAATCCGCAGACAGCTGCGC
TCCGTGGGGAAACCGAATCCGCATCCCAGTTCGACTATCATTTATCAATG
GAATGTGAGCGATGTACACGGTAGCAGAGCCGCAGACCACACGACTTCCC
GCCCCTCCGCAGTACACACGCCCCCCCTTTTGCAATTAGGGCCAACAAAT
GCTGACTGTCTTGGAAGTGGCAAGAGTTTTTGGGGGCCAGATATAAAGTA
TGGCAAAAGCTAAAATTGAACTTGTTTGCGCCACGCTAAGGAATTCACGA
AAATAAATGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTG
TGGCCACCGCCCGCCTGCTGTCCCGATCCGACTGGGGTGCCCGGCTGCCC
AAGTCCGTGGAGCACTTCCAGGGTCCCGCGCCCTACGTCATCATCCATCA
CTCGTACATGCCGGCCGTGTGCTACTCCACTCCGGACTGCATGAAGAGCA
TGCGGGACATGCAGGACTTCCATCAGCTGGAGCGCGGATGGAACGATATT
GGTTATAGCTTTGGCATCGGCGGCGATGGCATGATTTACACCGGCAGGGG
ATTCAATGTCATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGG
GCATTGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATG
CTGGATGCGGCCAAGAACCTGATCGCCTTTGGCGTTTTCAAGGGCTACAT
TGACCCTGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGT
GTCCTGGCGGCCGCCTGTTCGCCGAGATCTCCAGCTGGCCGCACTTTACC
CACATAAACGACACCGAAGGCGTCAGCAGCACCACGGCGCCCGTCGTGCC
CCACGTCCATCCACAGGCGGCAGCACCACAAAAGCCGCACCAATCCCCGC
CAGCTGCGCCCAAGGTCTAGGCTGGATTGGAGGGCCCTCATCGTCCTCGC
AAAGCTTACGAGTTTAAGAGAAGCCACAACGAGCTCGGCTCCACGCACAA
CGCCAAGGAGTTCATTCAGTATTCATTAGATGTCTCTTCTAACATTTCAC
AAATAAAGCAATTTCTAGATGATAACACTTAAACATAAAAAAAAAAAAAA
AAAAAAA

GH21008.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-LB-RA 1137 PGRP-LB-RA 2..1137 1..1136 5665 99.9 Plus
PGRP-LB.b 1058 PGRP-LB.b 150..982 306..1138 4165 100 Plus
PGRP-LB-RB 1108 PGRP-LB-RB 278..1107 309..1138 4150 100 Plus
PGRP-LB-RB 1108 PGRP-LB-RB 31..278 1..248 1240 100 Plus
PGRP-LB.b 1058 PGRP-LB.b 49..153 1..105 525 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7278313..7278771 1136..678 2295 100 Minus
chr3R 27901430 chr3R 7278924..7279292 677..309 1845 100 Minus
chr3R 27901430 chr3R 7279492..7279800 309..1 1530 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:01:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11452839..11453299 1138..678 2305 100 Minus
3R 32079331 3R 11453452..11453820 677..309 1845 100 Minus
3R 32079331 3R 11454020..11454328 309..1 1530 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11193670..11194130 1138..678 2305 100 Minus
3R 31820162 3R 11194283..11194651 677..309 1845 100 Minus
3R 31820162 3R 11194851..11195159 309..1 1530 99.6 Minus
Blast to na_te.dros performed on 2019-03-16 17:21:53 has no hits.

GH21008.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:22:55 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7278313..7278771 678..1136 100 <- Minus
chr3R 7278924..7279292 309..677 100 <- Minus
chr3R 7279493..7279800 1..308 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:50:58 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 38..699 309..970 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:51:22 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 38..699 309..970 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:54:51 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 38..699 309..970 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:20:27 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 38..699 309..970 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:57:20 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 38..699 309..970 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:36:13 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RA 2..1137 1..1136 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:51:22 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RA 2..1137 1..1136 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:54:51 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RA 2..1129 1..1128 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:20:27 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RA 2..1137 1..1136 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:57:20 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RA 2..1129 1..1128 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:22:55 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11452841..11453299 678..1136 100 <- Minus
3R 11453452..11453820 309..677 100 <- Minus
3R 11454021..11454328 1..308 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:22:55 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11452841..11453299 678..1136 100 <- Minus
3R 11453452..11453820 309..677 100 <- Minus
3R 11454021..11454328 1..308 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:22:55 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11452841..11453299 678..1136 100 <- Minus
3R 11453452..11453820 309..677 100 <- Minus
3R 11454021..11454328 1..308 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:54:51 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7279174..7279542 309..677 100 <- Minus
arm_3R 7279743..7280050 1..308 99   Minus
arm_3R 7278563..7279021 678..1136 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:57:10 Download gff for GH21008.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11193672..11194130 678..1136 100 <- Minus
3R 11194283..11194651 309..677 100 <- Minus
3R 11194852..11195159 1..308 99   Minus

GH21008.pep Sequence

Translation from 322 to 969

> GH21008.pep
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGVSSTTAPVVPHVHPQAA
APQKPHQSPPAAPKV*

GH21008.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16643-PA 226 GF16643-PA 20..225 4..214 959 84.8 Plus
Dana\GF10506-PA 187 GF10506-PA 27..187 18..178 407 46 Plus
Dana\GF23927-PA 182 GF23927-PA 10..178 6..175 375 44 Plus
Dana\GF12377-PA 185 GF12377-PA 24..184 15..176 343 40.1 Plus
Dana\GF21644-PA 185 GF21644-PA 24..184 15..176 343 40.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17219-PA 306 GG17219-PA 96..294 1..203 1047 94.6 Plus
Dere\GG15854-PA 190 GG15854-PA 30..187 18..175 410 46.2 Plus
Dere\GG23381-PA 184 GG23381-PA 23..182 15..175 369 41 Plus
Dere\GG13574-PA 182 GG13574-PA 11..178 7..175 348 41.4 Plus
Dere\GG19370-PA 345 GG19370-PA 177..342 15..180 347 42.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15357-PA 218 GH15357-PA 34..203 13..182 780 80.6 Plus
Dgri\GH15225-PA 191 GH15225-PA 31..191 18..178 397 44.7 Plus
Dgri\GH21355-PA 184 GH21355-PA 23..182 15..175 387 43.5 Plus
Dgri\GH20540-PA 184 GH20540-PA 23..182 15..175 374 41.6 Plus
Dgri\GH21354-PA 184 GH21354-PA 23..182 15..175 373 42.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-LB-PF 215 CG14704-PF 1..215 1..215 1176 100 Plus
PGRP-LB-PE 215 CG14704-PE 1..215 1..215 1176 100 Plus
PGRP-LB-PA 215 CG14704-PA 1..215 1..215 1176 100 Plus
PGRP-LB-PB 215 CG14704-PB 1..215 1..215 1176 100 Plus
PGRP-LB-PC 232 CG14704-PC 18..232 1..215 1176 100 Plus
PGRP-LB-PD 255 CG14704-PD 41..255 1..215 1176 100 Plus
PGRP-SB1-PA 190 CG9681-PA 30..187 18..175 393 44.9 Plus
PGRP-SC2-PA 184 CG14745-PA 23..182 15..175 343 40.4 Plus
PGRP-SB2-PA 182 CG9697-PA 14..178 10..175 336 39.8 Plus
PGRP-LE-PB 345 CG8995-PB 177..344 15..182 329 42.6 Plus
PGRP-LE-PA 345 CG8995-PA 177..344 15..182 329 42.6 Plus
PGRP-SC1b-PB 185 CG8577-PB 24..184 15..176 323 38.3 Plus
PGRP-SC1b-PA 185 CG8577-PA 24..184 15..176 323 38.3 Plus
PGRP-SC1a-PA 185 CG14746-PA 24..184 15..176 323 38.3 Plus
PGRP-LF-PA 369 CG4437-PA 59..220 15..176 307 39.3 Plus
PGRP-LC-PE 329 CG4432-PE 161..327 11..177 302 38.1 Plus
PGRP-LC-PD 500 CG4432-PD 332..498 11..177 302 38.1 Plus
PGRP-LC-PA 500 CG4432-PA 332..498 11..177 302 38.1 Plus
PGRP-SD-PA 186 CG7496-PA 22..183 15..176 294 37.4 Plus
PGRP-SA-PB 203 CG11709-PB 43..199 18..175 294 38 Plus
PGRP-SA-PA 203 CG11709-PA 43..199 18..175 294 38 Plus
PGRP-LC-PJ 340 CG4432-PJ 166..332 15..181 269 35.1 Plus
PGRP-LC-PC 511 CG4432-PC 337..503 15..181 269 35.1 Plus
PGRP-LA-PF 299 CG32042-PF 107..273 5..175 211 32.2 Plus
PGRP-LA-PE 368 CG32042-PE 176..342 5..175 211 32.2 Plus
PGRP-SB2-PB 191 CG9697-PB 14..121 10..118 200 37.7 Plus
PGRP-LC-PK 330 CG4432-PK 156..330 5..176 184 29.4 Plus
PGRP-LC-PI 501 CG4432-PI 327..501 5..176 184 29.4 Plus
PGRP-LC-PH 520 CG4432-PH 346..520 5..176 184 29.4 Plus
PGRP-LC-PB 520 CG4432-PB 346..520 5..176 184 29.4 Plus
PGRP-LA-PG 138 CG32042-PG 1..112 60..175 175 34.5 Plus
PGRP-LA-PC 138 CG32042-PC 1..112 60..175 175 34.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22456-PA 212 GI22456-PA 24..205 8..184 810 79.1 Plus
Dmoj\GI11935-PA 191 GI11935-PA 20..191 10..178 413 44.2 Plus
Dmoj\GI20770-PA 184 GI20770-PA 16..182 8..175 407 44 Plus
Dmoj\GI18809-PA 184 GI18809-PA 16..182 8..175 369 39.3 Plus
Dmoj\GI18808-PA 187 GI18808-PA 26..185 15..175 347 40.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12268-PA 310 GL12268-PA 117..281 13..177 881 92.7 Plus
Dper\GL17120-PA 185 GL17120-PA 24..184 15..176 342 40.1 Plus
Dper\GL17117-PA 185 GL17117-PA 24..184 15..176 342 40.1 Plus
Dper\GL18052-PA 353 GL18052-PA 185..348 15..178 341 42.4 Plus
Dper\GL13286-PA 130 GL13286-PA 2..126 50..175 298 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13189-PA 225 GA13189-PA 32..196 13..177 864 92.7 Plus
Dpse\GA21961-PA 188 GA21961-PA 28..188 18..178 395 45.3 Plus
Dpse\GA13217-PA 184 GA13217-PA 23..182 15..175 378 41.6 Plus
Dpse\GA24974-PA 185 GA24974-PA 24..184 15..176 342 40.1 Plus
Dpse\GA21174-PA 185 GA21174-PA 24..184 15..176 342 40.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26096-PA 232 GM26096-PA 18..232 1..215 1114 95.3 Plus
Dsec\GM24370-PA 190 GM24370-PA 30..187 18..175 414 46.2 Plus
Dsec\GM25654-PA 182 GM25654-PA 11..178 7..175 342 39.7 Plus
Dsec\GM21060-PA 185 GM21060-PA 24..184 15..176 332 38.3 Plus
Dsec\GM21059-PA 185 GM21059-PA 24..184 15..176 331 38.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15111-PA 295 GD15111-PA 81..295 1..215 1152 97.2 Plus
Dsim\PGRP-SB1-PA 190 GD12445-PA 30..187 18..175 412 46.2 Plus
Dsim\PGRP-SC2-PA 184 GD10595-PA 23..182 15..175 366 40.4 Plus
Dsim\GD24678-PA 345 GD24678-PA 177..344 15..182 351 42.6 Plus
Dsim\PGRP-SB2-PA 182 GD14659-PA 11..178 7..175 345 40 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10054-PA 214 GJ10054-PA 36..204 13..181 806 82.2 Plus
Dvir\GJ12160-PA 191 GJ12160-PA 31..191 18..178 403 44.7 Plus
Dvir\GJ20505-PA 184 GJ20505-PA 23..182 15..175 372 42.2 Plus
Dvir\GJ21836-PA 184 GJ21836-PA 23..182 15..175 364 39.8 Plus
Dvir\GJ18565-PA 366 GJ18565-PA 197..364 15..182 359 41.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11791-PA 212 GK11791-PA 18..209 1..191 840 81.8 Plus
Dwil\GK17343-PA 192 GK17343-PA 32..192 18..178 395 44.7 Plus
Dwil\GK17119-PA 173 GK17119-PA 1..169 6..175 377 45.3 Plus
Dwil\GK21737-PA 185 GK21737-PA 16..183 7..175 373 40.2 Plus
Dwil\GK21567-PA 187 GK21567-PA 26..185 15..175 339 39.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24618-PA 233 GE24618-PA 18..233 1..215 1066 91.2 Plus
Dyak\GE22193-PA 190 GE22193-PA 30..187 18..175 409 46.2 Plus
Dyak\GE19223-PA 184 GE19223-PA 23..182 15..175 367 40.4 Plus
Dyak\GE16017-PA 347 GE16017-PA 177..344 15..182 352 43.3 Plus
Dyak\GE19871-PA 184 GE19871-PA 14..180 8..175 347 40.5 Plus

GH21008.hyp Sequence

Translation from 322 to 969

> GH21008.hyp
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGVSSTTAPVVPHVHPQAA
APQKPHQSPPAAPKV*

GH21008.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-LB-PF 215 CG14704-PF 1..215 1..215 1176 100 Plus
PGRP-LB-PE 215 CG14704-PE 1..215 1..215 1176 100 Plus
PGRP-LB-PA 215 CG14704-PA 1..215 1..215 1176 100 Plus
PGRP-LB-PB 215 CG14704-PB 1..215 1..215 1176 100 Plus
PGRP-LB-PC 232 CG14704-PC 18..232 1..215 1176 100 Plus