Clone GH21395 Report

Search the DGRC for GH21395

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:213
Well:95
Vector:pOT2
Associated Gene/TranscriptCG1161-RA
Protein status:GH21395.pep: gold
Preliminary Size:1108
Sequenced Size:939

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1161-RA 2009-01-21 est gleaning
CG1161 2011-05-12 Manual selection by Charles Yu

Clone Sequence Records

GH21395.complete Sequence

939 bp assembled on 2011-09-22

GenBank Submission: BT132641.1

> GH21395.complete
CGAAATTGCAAGGGAATTTTCTCCAATAAAAGGCAAGAAAACTGAGGAAA
ATTGAAATTAAAGAAAAATTAATGGCACACAAGCGCCTGTTCGTCTACGC
GGTGCTACTGGTGATATGTTATTTGGTTGGCGTGACATGGGCTGAGACTG
CGGCGCAGACATTCCCAGCGATCGGCACCAACAGCAACAACAACAGCAAT
GCTCAACCTGCTCCTGTGCCTGCACCTGCAGCTCCAGCGGCTGCAGCTCC
ACTAGCCAAGCAAGTTTCAGCTCCCACTGCCGCCCCTCCGGCCAAGGTCA
TCGGCCAGCCTGTGCTCGCTGCTCCAGGCAAAAATTCTTCCAATTCCAGC
AGCACAACTGAGTGCGTCTGTGCCGGTGCCCTGCTGCCCCGTTTGGATGC
CAATGGCAAGGAGCTGCCCATATGCGCCGAGTGCAAGTGCTCCCATGTGG
CGAGAAATACGACGCTGATAAAGGTCGTGGTCATTATTGTGATTTGGATC
ATCTCCATTTTAGTAATATACATGCTCTTCCTGATGTGCCTGGACCCGTT
GCTGAACAAGCGAGTGAAGGCGAACTACCAGGAGCACACCAACGAAGATG
ATGAACCAACGCCGCCCCTGCCAGCCGTCAACAACCAGGAGCTCAGTGCC
AGAGCCAATGTCCTCAATCGTGTGGGCCACCAGCAGGACAAGTGGAAGCG
GCAGGTGCGCGAGCAGAGACGCCACATCTACGACAGGCATACCATGCTAA
ACTAACAAGGGGTTCGGTTTGCAGCTGGCGGAGATTAGGAGGCGCATGGG
CGACTTAAGACACGTATTCCAAGCAGTTATCCTTTGCGAAATTCCCCTTT
GGATCAAATTGATTATCTGTATATTTAGCCAGATTTTATGTTAATTAAAA
TAAACCAAAATATGTTTGTCAAAAAAAAAAAAAAAAAAA

GH21395.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1182088..1182408 600..920 1605 100 Plus
chr3R 27901430 chr3R 1180989..1181213 140..364 1125 100 Plus
chr3R 27901430 chr3R 1180777..1180917 1..141 705 100 Plus
chr3R 27901430 chr3R 1181664..1181792 472..600 645 100 Plus
chr3R 27901430 chr3R 1181496..1181607 364..475 560 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5356425..5356746 600..921 1610 100 Plus
3R 32079331 3R 5355326..5355550 140..364 1125 100 Plus
3R 32079331 3R 5355114..5355254 1..141 705 100 Plus
3R 32079331 3R 5356001..5356129 472..600 645 100 Plus
3R 32079331 3R 5355833..5355944 364..475 560 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5097256..5097577 600..921 1610 100 Plus
3R 31820162 3R 5096157..5096381 140..364 1125 100 Plus
3R 31820162 3R 5095945..5096085 1..141 705 100 Plus
3R 31820162 3R 5096832..5096960 472..600 645 100 Plus
3R 31820162 3R 5096664..5096775 364..475 560 100 Plus
Blast to na_te.dros performed 2019-03-15 11:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6735..6851 171..283 152 61.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2301..2393 170..263 143 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2452..2571 171..279 142 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2323..2424 171..277 136 61.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2783..2871 152..247 129 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6756..6875 171..292 128 57.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1526..1589 135..199 124 67.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6777..6872 171..271 124 61.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6792 177..251 118 64 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2382..2502 176..305 114 60 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2394..2467 176..251 114 63.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6796..6900 147..251 111 60.2 Plus

GH21395.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:09:43 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1181666..1181791 474..599 100 -> Plus
chr3R 1180777..1180916 1..140 100 -> Plus
chr3R 1180990..1181213 141..364 100 -> Plus
chr3R 1181497..1181605 365..473 100 -> Plus
chr3R 1182088..1182408 600..920 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-09-22 10:35:22 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
CG1161-RA 1..684 72..755 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:37:03 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
CG1161-RA 1..684 72..755 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:23:44 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
CG1161-RA 1..684 72..755 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 10:35:21 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
CG1161-RA 15..934 1..920 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:37:03 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
CG1161-RA 23..942 1..920 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:23:44 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
CG1161-RA 23..942 1..920 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:09:43 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5356003..5356128 474..599 100 -> Plus
3R 5355114..5355253 1..140 100 -> Plus
3R 5355327..5355550 141..364 100 -> Plus
3R 5355834..5355942 365..473 100 -> Plus
3R 5356425..5356745 600..920 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:09:43 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5356003..5356128 474..599 100 -> Plus
3R 5355114..5355253 1..140 100 -> Plus
3R 5355327..5355550 141..364 100 -> Plus
3R 5355834..5355942 365..473 100 -> Plus
3R 5356425..5356745 600..920 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:09:43 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5356003..5356128 474..599 100 -> Plus
3R 5355114..5355253 1..140 100 -> Plus
3R 5355327..5355550 141..364 100 -> Plus
3R 5355834..5355942 365..473 100 -> Plus
3R 5356425..5356745 600..920 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:37:03 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1180836..1180975 1..140 100 -> Plus
arm_3R 1181049..1181272 141..364 100 -> Plus
arm_3R 1181556..1181664 365..473 100 -> Plus
arm_3R 1181725..1181850 474..599 100 -> Plus
arm_3R 1182147..1182467 600..920 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:34:43 Download gff for GH21395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5096665..5096773 365..473 100 -> Plus
3R 5096834..5096959 474..599 100 -> Plus
3R 5096158..5096381 141..364 100 -> Plus
3R 5097256..5097576 600..920 100   Plus
3R 5095945..5096084 1..140 100 -> Plus

GH21395.hyp Sequence

Translation from 71 to 754

> GH21395.hyp
MAHKRLFVYAVLLVICYLVGVTWAETAAQTFPAIGTNSNNNSNAQPAPVP
APAAPAAAAPLAKQVSAPTAAPPAKVIGQPVLAAPGKNSSNSSSTTECVC
AGALLPRLDANGKELPICAECKCSHVARNTTLIKVVVIIVIWIISILVIY
MLFLMCLDPLLNKRVKANYQEHTNEDDEPTPPLPAVNNQELSARANVLNR
VGHQQDKWKRQVREQRRHIYDRHTMLN*

GH21395.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG1161-PA 227 CG1161-PA 1..227 1..227 1183 100 Plus
CG1161-PC 221 CG1161-PC 1..176 1..176 907 100 Plus

GH21395.pep Sequence

Translation from 71 to 754

> GH21395.pep
MAHKRLFVYAVLLVICYLVGVTWAETAAQTFPAIGTNSNNNSNAQPAPVP
APAAPAAAAPLAKQVSAPTAAPPAKVIGQPVLAAPGKNSSNSSSTTECVC
AGALLPRLDANGKELPICAECKCSHVARNTTLIKVVVIIVIWIISILVIY
MLFLMCLDPLLNKRVKANYQEHTNEDDEPTPPLPAVNNQELSARANVLNR
VGHQQDKWKRQVREQRRHIYDRHTMLN*

GH21395.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20761-PA 254 GF20761-PA 1..254 1..227 743 66.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12738-PA 259 GG12738-PA 1..259 1..227 866 77.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17779-PA 222 GH17779-PA 1..222 1..227 705 75.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG1161-PA 227 CG1161-PA 1..227 1..227 1183 100 Plus
CG1161-PC 221 CG1161-PC 1..176 1..176 907 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22547-PA 216 GI22547-PA 1..216 1..227 668 72.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21638-PA 240 GL21638-PA 1..240 1..227 736 74.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11097-PA 240 GA11097-PA 1..240 1..227 736 74.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10801-PA 277 GM10801-PA 1..277 1..227 794 74.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19778-PA 263 GD19778-PA 1..263 1..227 829 83.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11105-PA 213 GJ11105-PA 1..213 1..227 665 70.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12969-PA 227 GK12969-PA 1..227 1..227 682 70.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25460-PA 266 GE25460-PA 1..266 1..227 821 73.7 Plus