Clone GH21617 Report

Search the DGRC for GH21617

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:216
Well:17
Vector:pOT2
Associated Gene/TranscriptSfp87B-RA
Protein status:GH21617.pep: gold
Sequenced Size:404

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Sfp87B 2008-12-18 5.12 accounting

Clone Sequence Records

GH21617.complete Sequence

404 bp (404 high quality bases) assembled on 2006-07-25

GenBank Submission: BT028768

> GH21617.complete
AGAGATTTAAGCTTTTGCAATTTCCCGTATCAAAAGTGGAAATGCGTTTC
GTATTTGTATTCGTCCTGTTATCGGTCCTGGCTCTCAGTCTGGTTTCCGC
CAAGGAACAATCAAAAACTAGCTCATCGCCAGGAAGGAACAATGTCGGAG
CCACAGTAAACCCTCGATTGCGTCCCAAGCGTAATATATTGTTCAATAGG
CCCACCATTCGTGGTCAAGTGCAACGCTATATCTATGGTTATCCCTATCA
TAATGGGGTTCCTACGTACTACAAATACCCGTACTACGGCTACTTCAGGA
TCTAATCCTTTAGCTAGAGAATGCTGCAAATAAATGATTACTGAATGGTT
TTCCTTGTGATTTCAATGACCATCACAGCTTCGAAAAAAAAAAAAAAAAA
AAAA

GH21617.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp87B-RA 396 Sfp87B-RA 14..396 1..383 1915 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8098526..8098908 1..383 1915 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:02:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12273139..12273524 1..386 1930 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12013970..12014355 1..386 1930 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:30:01 has no hits.

GH21617.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:30:50 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8098526..8098908 1..383 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:51:39 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 1..264 42..305 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:21:08 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 1..264 42..305 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:30:39 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 1..264 42..305 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:39:23 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:15 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 1..264 42..305 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:49:42 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 14..396 1..383 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:21:08 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 14..396 1..383 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:30:39 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 14..396 1..383 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 15:39:23 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:15 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 14..396 1..383 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:50 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12273139..12273521 1..383 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:50 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12273139..12273521 1..383 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:50 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12273139..12273521 1..383 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:30:39 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8098861..8099243 1..383 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:58 Download gff for GH21617.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12013970..12014352 1..383 100   Plus

GH21617.hyp Sequence

Translation from 2 to 304

> GH21617.hyp
RFKLLQFPVSKVEMRFVFVFVLLSVLALSLVSAKEQSKTSSSPGRNNVGA
TVNPRLRPKRNILFNRPTIRGQVQRYIYGYPYHNGVPTYYKYPYYGYFRI
*

GH21617.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp87B-PA 87 CG42485-PA 1..87 14..100 459 100 Plus

GH21617.pep Sequence

Translation from 2 to 304

> GH21617.pep
RFKLLQFPVSKVEMRFVFVFVLLSVLALSLVSAKEQSKTSSSPGRNNVGA
TVNPRLRPKRNILFNRPTIRGQVQRYIYGYPYHNGVPTYYKYPYYGYFRI
*

GH21617.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp87B-PA 87 CG42485-PA 1..87 14..100 459 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24009-PA 87 GM24009-PA 1..87 14..100 431 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18808-PA 87 GD18808-PA 1..87 14..100 436 97.7 Plus