GH21617.complete Sequence
404 bp (404 high quality bases) assembled on 2006-07-25
GenBank Submission: BT028768
> GH21617.complete
AGAGATTTAAGCTTTTGCAATTTCCCGTATCAAAAGTGGAAATGCGTTTC
GTATTTGTATTCGTCCTGTTATCGGTCCTGGCTCTCAGTCTGGTTTCCGC
CAAGGAACAATCAAAAACTAGCTCATCGCCAGGAAGGAACAATGTCGGAG
CCACAGTAAACCCTCGATTGCGTCCCAAGCGTAATATATTGTTCAATAGG
CCCACCATTCGTGGTCAAGTGCAACGCTATATCTATGGTTATCCCTATCA
TAATGGGGTTCCTACGTACTACAAATACCCGTACTACGGCTACTTCAGGA
TCTAATCCTTTAGCTAGAGAATGCTGCAAATAAATGATTACTGAATGGTT
TTCCTTGTGATTTCAATGACCATCACAGCTTCGAAAAAAAAAAAAAAAAA
AAAA
GH21617.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:13:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp87B-RA | 396 | Sfp87B-RA | 14..396 | 1..383 | 1915 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:30:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 8098526..8098908 | 1..383 | 1915 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:02:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 12273139..12273524 | 1..386 | 1930 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 12013970..12014355 | 1..386 | 1930 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 15:30:01 has no hits.
GH21617.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:30:50 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 8098526..8098908 | 1..383 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:51:39 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp87B-RA | 1..264 | 42..305 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:21:08 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp87B-RA | 1..264 | 42..305 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:30:39 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp87B-RA | 1..264 | 42..305 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:39:23 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:15 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp87B-RA | 1..264 | 42..305 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:49:42 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp87B-RA | 14..396 | 1..383 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:21:08 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp87B-RA | 14..396 | 1..383 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:30:39 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp87B-RA | 14..396 | 1..383 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 15:39:23 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:15 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp87B-RA | 14..396 | 1..383 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:50 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12273139..12273521 | 1..383 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:50 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12273139..12273521 | 1..383 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:50 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12273139..12273521 | 1..383 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:30:39 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 8098861..8099243 | 1..383 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:58 Download gff for
GH21617.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12013970..12014352 | 1..383 | 100 | | Plus |
GH21617.hyp Sequence
Translation from 2 to 304
> GH21617.hyp
RFKLLQFPVSKVEMRFVFVFVLLSVLALSLVSAKEQSKTSSSPGRNNVGA
TVNPRLRPKRNILFNRPTIRGQVQRYIYGYPYHNGVPTYYKYPYYGYFRI
*
GH21617.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:39:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp87B-PA | 87 | CG42485-PA | 1..87 | 14..100 | 459 | 100 | Plus |
GH21617.pep Sequence
Translation from 2 to 304
> GH21617.pep
RFKLLQFPVSKVEMRFVFVFVLLSVLALSLVSAKEQSKTSSSPGRNNVGA
TVNPRLRPKRNILFNRPTIRGQVQRYIYGYPYHNGVPTYYKYPYYGYFRI
*
GH21617.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp87B-PA | 87 | CG42485-PA | 1..87 | 14..100 | 459 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:55:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24009-PA | 87 | GM24009-PA | 1..87 | 14..100 | 431 | 96.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:55:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18808-PA | 87 | GD18808-PA | 1..87 | 14..100 | 436 | 97.7 | Plus |