Clone GH21666 Report

Search the DGRC for GH21666

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:216
Well:66
Vector:pOT2
Associated Gene/TranscriptCG30090-RA
Protein status:GH21666.pep: gold
Preliminary Size:1185
Sequenced Size:1004

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8215 2001-01-01 Release 2 assignment
CG30090 2002-07-13 Blastp of sequenced clone
CG30090 2003-01-01 Sim4 clustering to Release 3
CG30090 2008-04-29 Release 5.5 accounting
CG30090 2008-08-15 Release 5.9 accounting
CG30090 2008-12-18 5.12 accounting

Clone Sequence Records

GH21666.complete Sequence

1004 bp (1004 high quality bases) assembled on 2002-07-13

GenBank Submission: BT001434

> GH21666.complete
TACAGATGTGGGGCGCTATTGCAGCGATCACAGCTCTGGCAATTGGAGTC
CTCTGTTCTCTGGGCAATGGAGAGTACTTGGAACCGAGGTGCGGGCTAAC
TGCAAATACTATCGCTTTTAAAATAATTGGTGGCAGAGATGCGATCATAA
ACTCAAATCCGTGGATGGCCTACATCCATTCCTCCGTCAAATTAATCTGC
GGAGGAACTCTCATTACCCAGCGGTTTGTCCTAACAGCAGCGCATTGTGT
TAACGAAGGAAGTGCGGTAAAGGTGCGACTCGGTGAGTACGATGATACTG
CGACAGAGGACTGCAACAGCAAGATCTGCATCCCAAGGGCTGAGGAGCAC
GATGTGGACATGGCCTTCCGGCATGGAAAGTTCTCTGAGATCAAAAACCT
GAACGACATCGCGCTCCTTCGCTTGGCCAAATTTGTGACTTTCAAAGCTC
ACATCTCGCCCATTTGCATCATTTTGGGTACCTCCAAGAGGGAATTAGTC
GATAGCATAGAATGGTTTGTTGCCACCGGTTGGGGCGAGACTAGAACACA
CAGGACACGAGGTGTTCTGCAGATCACCCAGCTCCAGCGCTATAATTCAT
CCCAGTGCATGCAAGCTCTTGGCAGGTTAGTGCAGCAGAACCAAATTTGC
GCCGGACGCCTTGGATCCGATACGTGCAACGGAGACTCCGGCGGTCCGCT
CTTCCAGACTGTGCGCCACATGGACAAAATGCGTCCCGTGCAATTCGGAG
TCGTCAGCTACGGCAGCAGGGAGTGCTCCGGAATCGGTGTCTATACGGAT
GTGTACAGCTACGCCGATTGGATCGCAACCGTGGTGCAGCAGAACACCCA
TGTGCCCGCACCCATAATGCCAAACATTTAATCTTAAATTTATAATTACA
CCTAATTGTAAAATAGACAATAGTTGATTGATTTTCAATGCTGTTGTCTT
TTTAAATGAAAAATATATAATTTTAAAAATTGAAAAAAAAAAAAAAAAAA
AAAA

GH21666.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG30090-RA 1176 CG30090-RA 188..1170 1..983 4915 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11577656..11578192 446..982 2610 99.1 Plus
chr2R 21145070 chr2R 11577021..11577243 1..223 1115 100 Plus
chr2R 21145070 chr2R 11577432..11577610 269..447 895 100 Plus
chr2R 21145070 chr2R 11577299..11577344 223..268 230 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:02:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15690478..15691015 446..983 2690 100 Plus
2R 25286936 2R 15689843..15690065 1..223 1115 100 Plus
2R 25286936 2R 15690254..15690432 269..447 895 100 Plus
2R 25286936 2R 15690121..15690166 223..268 230 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15691677..15692214 446..983 2690 100 Plus
2R 25260384 2R 15691042..15691264 1..223 1115 100 Plus
2R 25260384 2R 15691453..15691631 269..447 895 100 Plus
2R 25260384 2R 15691320..15691365 223..268 230 100 Plus
Blast to na_te.dros performed 2019-03-16 06:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 6532..6612 886..968 113 61.4 Plus

GH21666.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:10:08 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11577021..11577242 1..222 100 -> Plus
chr2R 11577299..11577344 223..268 100 -> Plus
chr2R 11577432..11577610 269..447 100 -> Plus
chr2R 11577658..11578155 448..945 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:51:45 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
CG30090-RA 1..876 6..881 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:17:26 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
CG30090-RA 1..876 6..881 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:38:40 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
CG30090-RA 1..876 6..881 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:08:38 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
CG30090-RA 1..876 6..881 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:12:50 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
CG30090-RA 1..876 6..881 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:41:50 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
CG30090-RA 1..982 1..982 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:17:26 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
CG30090-RA 1..982 1..982 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:38:40 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
CG30090-RA 18..999 1..982 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:08:39 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
CG30090-RA 1..982 1..982 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:12:50 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
CG30090-RA 18..999 1..982 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:08 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15689843..15690064 1..222 100 -> Plus
2R 15690121..15690166 223..268 100 -> Plus
2R 15690254..15690432 269..447 100 -> Plus
2R 15690480..15691014 448..982 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:08 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15689843..15690064 1..222 100 -> Plus
2R 15690121..15690166 223..268 100 -> Plus
2R 15690254..15690432 269..447 100 -> Plus
2R 15690480..15691014 448..982 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:08 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15689843..15690064 1..222 100 -> Plus
2R 15690121..15690166 223..268 100 -> Plus
2R 15690254..15690432 269..447 100 -> Plus
2R 15690480..15691014 448..982 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:38:40 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11577348..11577569 1..222 100 -> Plus
arm_2R 11577626..11577671 223..268 100 -> Plus
arm_2R 11577759..11577937 269..447 100 -> Plus
arm_2R 11577985..11578519 448..982 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:40:36 Download gff for GH21666.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15691042..15691263 1..222 100 -> Plus
2R 15691320..15691365 223..268 100 -> Plus
2R 15691453..15691631 269..447 100 -> Plus
2R 15691679..15692213 448..982 100   Plus

GH21666.hyp Sequence

Translation from 2 to 880

> GH21666.hyp
QMWGAIAAITALAIGVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIIN
SNPWMAYIHSSVKLICGGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTA
TEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAH
ISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSS
QCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGV
VSYGSRECSGIGVYTDVYSYADWIATVVQQNTHVPAPIMPNI*

GH21666.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG30090-PA 291 CG30090-PA 1..291 2..292 1538 100 Plus
CG30286-PB 277 CG30286-PB 20..277 24..284 547 39.5 Plus
CG30088-PB 281 CG30088-PB 28..279 25..281 546 42.6 Plus
CG18636-PA 349 CG18636-PA 24..281 21..277 544 41.3 Plus
CG30082-PB 280 CR30082-PB 22..276 24..279 528 43 Plus

GH21666.pep Sequence

Translation from 5 to 880

> GH21666.pep
MWGAIAAITALAIGVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINS
NPWMAYIHSSVKLICGGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTAT
EDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHI
SPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQ
CMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVV
SYGSRECSGIGVYTDVYSYADWIATVVQQNTHVPAPIMPNI*

GH21666.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13370-PA 505 GF13370-PA 9..279 24..279 425 36 Plus
Dana\GF11497-PA 284 GF11497-PA 6..276 11..281 424 37.1 Plus
Dana\GF23281-PA 372 GF23281-PA 108..363 34..273 393 35.5 Plus
Dana\GF11318-PA 308 GF11318-PA 1..216 54..279 391 39.7 Plus
Dana\GF12091-PA 280 GF12091-PA 2..267 4..280 370 32.6 Plus
Dana\GF13370-PA 505 GF13370-PA 298..503 45..279 174 27.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20540-PA 291 GG20540-PA 1..291 1..291 1180 73.9 Plus
Dere\GG20542-PA 281 GG20542-PA 26..281 22..282 545 43.1 Plus
Dere\GG20771-PA 275 GG20771-PA 5..274 11..279 543 39.2 Plus
Dere\GG24240-PA 374 GG24240-PA 7..275 7..276 503 39.9 Plus
Dere\GG20543-PA 280 GG20543-PA 22..276 21..278 494 38.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20292-PA 242 GH20292-PA 2..242 50..280 427 40.2 Plus
Dgri\GH20291-PA 237 GH20291-PA 9..231 58..274 405 40.8 Plus
Dgri\GH20624-PA 374 GH20624-PA 107..371 29..280 392 35.1 Plus
Dgri\GH17524-PA 374 GH17524-PA 107..371 29..280 392 35.1 Plus
Dgri\GH23917-PA 235 GH23917-PA 6..229 43..274 387 38.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG30090-PA 291 CG30090-PA 1..291 1..291 1538 100 Plus
CG30286-PB 277 CG30286-PB 20..277 23..283 547 39.5 Plus
CG30088-PB 281 CG30088-PB 28..279 24..280 546 42.6 Plus
CG18636-PA 349 CG18636-PA 24..281 20..276 544 41.3 Plus
CG30082-PB 280 CR30082-PB 22..276 23..278 528 43 Plus
CG43335-PA 281 CG43335-PA 16..278 16..279 509 41.4 Plus
CG30087-PA 277 CG30087-PA 22..270 21..273 495 38.2 Plus
CG43336-PA 279 CG43336-PA 5..274 8..276 477 37.3 Plus
CG33462-PA 300 CG33462-PA 6..275 11..279 477 37.6 Plus
CG30287-PA 284 CG30287-PA 4..284 3..280 474 38.5 Plus
CG30288-PC 282 CG30288-PC 8..278 5..281 470 41.2 Plus
CG33461-PB 287 CG33461-PB 10..282 8..277 461 37.6 Plus
CG33458-PA 281 CG33458-PA 6..281 6..282 459 36.9 Plus
CG30083-PB 279 CG30083-PB 19..263 23..281 458 40.2 Plus
CG30187-PE 489 CG30187-PE 15..266 16..279 455 39.5 Plus
CG30187-PF 500 CG30187-PF 15..266 16..279 455 39.5 Plus
CG10764-PA 523 CG10764-PA 3..271 4..284 447 36.6 Plus
CG33225-PB 292 CG33225-PB 5..283 5..281 446 38.7 Plus
CG33225-PC 307 CG33225-PC 20..298 5..281 446 38.7 Plus
CG33459-PA 284 CG33459-PA 25..272 25..273 445 41.7 Plus
CG18420-PA 299 CG18420-PA 13..267 11..276 444 39.6 Plus
CG33226-PC 292 CG33226-PC 19..290 11..281 438 37.8 Plus
CG30283-PB 273 CG30283-PB 9..269 5..279 433 37.7 Plus
CG30091-PA 526 CG30091-PA 18..277 20..277 424 38.3 Plus
CG43110-PA 483 CG43110-PA 10..259 16..278 418 38.8 Plus
CG43110-PB 483 CG43110-PB 10..259 16..278 418 38.8 Plus
CG30289-PA 316 CG30289-PA 26..271 25..273 414 38.3 Plus
CG43742-PB 474 CG43742-PB 31..260 36..280 407 40.2 Plus
CG30098-PA 264 CG30098-PA 1..262 1..280 394 35.2 Plus
CG4650-PB 299 CG4650-PB 19..264 20..279 389 34.5 Plus
grass-PA 335 CG5896-PA 69..333 29..280 388 33.6 Plus
grass-PB 377 CG5896-PB 111..375 29..280 388 33.6 Plus
CG30414-PC 305 CG30414-PC 4..295 5..278 385 34.9 Plus
CG30414-PB 305 CG30414-PB 4..295 5..278 385 34.9 Plus
CG30002-PB 311 CG30002-PB 6..301 7..273 382 36.5 Plus
CG5909-PA 381 CG5909-PA 122..381 29..278 377 35.2 Plus
CG1773-PA 317 CG1773-PA 7..301 8..273 364 35.3 Plus
CG33465-PC 488 CG33465-PC 10..266 13..278 340 34.6 Plus
Sp7-PF 391 CG3066-PF 118..390 19..278 337 34.5 Plus
Sp7-PE 391 CG3066-PE 118..390 19..278 337 34.5 Plus
Sp7-PA 391 CG3066-PA 118..390 19..278 337 34.5 Plus
CG16710-PB 372 CG16710-PB 103..362 37..273 329 36.4 Plus
CG9737-PA 424 CG9737-PA 134..412 21..279 325 34.3 Plus
MP1-PA 390 CG1102-PA 116..389 25..278 320 33.9 Plus
MP1-PC 399 CG1102-PC 125..398 25..278 320 33.9 Plus
MP1-PE 400 CG1102-PE 126..399 25..278 320 33.9 Plus
CG14088-PB 289 CG14088-PB 8..274 5..287 319 27.8 Plus
CG31219-PB 345 CG31219-PB 80..344 29..278 319 36.1 Plus
ea-PA 392 CG4920-PA 113..391 25..278 318 33.8 Plus
CG30286-PC 152 CG30286-PC 20..142 23..147 313 45.6 Plus
CG14227-PB 286 CG14227-PB 53..277 48..273 307 33.9 Plus
CG30091-PA 526 CG30091-PA 309..525 43..278 223 28.8 Plus
CG33465-PC 488 CG33465-PC 293..488 53..280 161 27.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23202-PA 376 GI23202-PA 112..374 34..280 400 34.2 Plus
Dmoj\GI22268-PA 380 GI22268-PA 120..379 29..277 390 37.5 Plus
Dmoj\GI24877-PA 392 GI24877-PA 113..391 25..278 337 34.8 Plus
Dmoj\GI10853-PA 285 GI10853-PA 13..284 27..278 333 35.1 Plus
Dmoj\GI24127-PA 389 GI24127-PA 114..388 18..278 328 34.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11857-PA 283 GL11857-PA 5..279 5..280 689 47.5 Plus
Dper\GL11858-PA 345 GL11858-PA 1..290 1..286 654 44.7 Plus
Dper\GL17488-PA 282 GL17488-PA 4..278 4..278 595 44.6 Plus
Dper\GL11321-PA 284 GL11321-PA 1..283 1..283 518 40.8 Plus
Dper\GL16656-PA 282 GL16656-PA 4..280 7..281 510 40.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15642-PA 283 GA15642-PA 5..279 5..280 688 47.8 Plus
Dpse\GA25145-PA 345 GA25145-PA 1..290 1..286 651 44.3 Plus
Dpse\GA24176-PA 282 GA24176-PA 4..278 4..278 596 44.9 Plus
Dpse\GA24684-PA 282 GA24684-PA 4..280 6..281 525 41.6 Plus
Dpse\GA24468-PA 278 GA24468-PA 3..274 4..278 521 38.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21631-PA 291 GM21631-PA 1..291 1..291 1316 85.9 Plus
Dsec\GM14686-PA 346 GM14686-PA 7..281 3..276 538 39.9 Plus
Dsec\GM15715-PA 277 GM15715-PA 19..277 22..282 526 38 Plus
Dsec\GM21635-PA 302 GM21635-PA 6..275 11..279 495 37.6 Plus
Dsec\GM21633-PA 279 GM21633-PA 22..270 21..273 494 38.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11133-PA 295 GD11133-PA 1..289 1..289 1321 86.9 Plus
Dsim\GD25604-PA 280 GD25604-PA 21..276 22..278 560 44.4 Plus
Dsim\GD19032-PA 401 GD19032-PA 116..399 3..280 528 40.4 Plus
Dsim\GD11200-PA 251 GD11200-PA 1..243 38..277 495 41 Plus
Dsim\GD11137-PA 302 GD11137-PA 6..275 11..279 492 37.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21978-PA 296 GJ21978-PA 36..295 28..280 501 39.9 Plus
Dvir\GJ21212-PA 268 GJ21212-PA 6..268 26..280 476 39.6 Plus
Dvir\GJ21214-PA 280 GJ21214-PA 18..280 26..280 469 39.2 Plus
Dvir\GJ22863-PA 372 GJ22863-PA 106..370 29..280 390 34.3 Plus
Dvir\GJ24059-PA 397 GJ24059-PA 118..393 18..274 371 34.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23933-PA 280 GK23933-PA 6..250 39..273 417 39 Plus
Dwil\GK11884-PA 375 GK11884-PA 108..373 28..280 371 33.1 Plus
Dwil\GK12018-PA 384 GK12018-PA 117..383 25..278 361 36.2 Plus
Dwil\GK11885-PA 388 GK11885-PA 128..383 29..273 352 33.8 Plus
Dwil\GK13139-PA 356 GK13139-PA 71..355 25..280 338 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11725-PA 296 GE11725-PA 1..288 1..291 1139 73.2 Plus
Dyak\GE11726-PA 282 GE11726-PA 1..282 1..282 554 40.6 Plus
Dyak\GE13707-PA 275 GE13707-PA 17..272 20..277 538 40.2 Plus
Dyak\GE13702-PA 297 GE13702-PA 16..277 19..279 521 43.3 Plus
Dyak\GE11727-PA 280 GE11727-PA 23..280 22..282 505 37.3 Plus