Clone GH21762 Report

Search the DGRC for GH21762

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:217
Well:62
Vector:pOT2
Associated Gene/TranscriptCG34168-RA
Protein status:GH21762.pep: gold
Preliminary Size:458
Sequenced Size:470

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4959 2002-01-01 Sim4 clustering to Release 2
CG4959 2002-05-18 Blastp of sequenced clone
CG34168 2008-04-29 Release 5.5 accounting
CG34168 2008-08-15 Release 5.9 accounting
CG34168 2008-12-18 5.12 accounting

Clone Sequence Records

GH21762.complete Sequence

470 bp (470 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118808.1

> GH21762.complete
CAGAAAACATCTATTTGTACGACTACCAAATTTCTAGGACTGAAAATCCT
ACTTCCGTAATCAGGCTAATAATAAAATGTGCAATCCAGGAATGTGCTCG
ATGCCCGGCACTTGCTGTGGACCGACTGGCGGACTGGGACCCTGCCTGCT
CTGCGGACCCTACAATGGCCAGTGGTTCCGTTCGGTCAACCACTGTTGCG
GTCCTTGTGGCCCATATGGTTGCTGCTCATGCTACGGGCCGTATGGTGGA
CATTGTTAGCCTGCTTAGAAGGAATGTAGGGTTTCTTTATCCGCGATCTG
GAACAGGAGCTTTAAAGATTGCAGCCGTGAGGCCTTGTCGAAGATGAGGA
GCCACGCTGAAAAGTTGTCAGGCAAAGTGGATCCAAAGATTTGTGTTCGA
TGAAAGATTATGCCATCAGAAATAGATGTTAATAAATTATACGTATAATT
CAAAAAAAAAAAAAAAAAAA

GH21762.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34168-RA 589 CG34168-RA 115..570 1..456 2280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16133517..16133897 451..71 1905 100 Minus
chr2L 23010047 chr2L 16133965..16134034 70..1 350 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:02:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16134709..16135094 456..71 1930 100 Minus
2L 23513712 2L 16135162..16135231 70..1 350 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16134709..16135094 456..71 1930 100 Minus
2L 23513712 2L 16135162..16135231 70..1 350 100 Minus
Blast to na_te.dros performed 2019-03-15 21:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 5348..5426 394..316 106 62.5 Minus

GH21762.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:14:02 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16133517..16133897 71..451 100 <- Minus
chr2L 16133965..16134034 1..70 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:51:50 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 1..183 77..259 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:42 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 1..183 77..259 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:40:06 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 1..183 77..259 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:07 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 1..183 77..259 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:45:59 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 1..183 77..259 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:49 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 7..457 1..451 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:42 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 7..457 1..451 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:40:06 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 42..492 1..451 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:07 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 7..457 1..451 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:59 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 42..492 1..451 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:02 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16135162..16135231 1..70 100   Minus
2L 16134714..16135094 71..451 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:02 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16135162..16135231 1..70 100   Minus
2L 16134714..16135094 71..451 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:02 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16135162..16135231 1..70 100   Minus
2L 16134714..16135094 71..451 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:40:06 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16134714..16135094 71..451 100 <- Minus
arm_2L 16135162..16135231 1..70 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:12 Download gff for GH21762.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16134714..16135094 71..451 100 <- Minus
2L 16135162..16135231 1..70 100   Minus

GH21762.hyp Sequence

Translation from 2 to 346

> GH21762.hyp
ENIYLYDYQISRTENPTSVIRLIIKCAIQECARCPALAVDRLADWDPACS
ADPTMASGSVRSTTVAVLVAHMVAAHATGRMVDIVSLLRRNVGFLYPRSG
TGALKIAAVRPCRR*
Sequence GH21762.hyp has no blast hits.

GH21762.pep Sequence

Translation from 76 to 258

> GH21762.pep
MCNPGMCSMPGTCCGPTGGLGPCLLCGPYNGQWFRSVNHCCGPCGPYGCC
SCYGPYGGHC*

GH21762.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14962-PA 63 GF14962-PA 4..63 1..60 262 90 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34168-PA 60 CG34168-PA 1..60 1..60 399 100 Plus
Mst84Da-PA 63 CG17946-PA 6..57 3..60 134 46.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21273-PA 60 GL21273-PA 1..60 1..60 264 93.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18555-PA 60 GA18555-PA 1..60 1..60 264 93.3 Plus
Dpse\GA25906-PA 72 GA25906-PA 16..72 3..60 160 62.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:36:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18109-PA 60 GK18109-PA 1..60 1..60 201 88.3 Plus