Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
GH21762.complete Sequence
470 bp (470 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118808.1
> GH21762.complete
CAGAAAACATCTATTTGTACGACTACCAAATTTCTAGGACTGAAAATCCT
ACTTCCGTAATCAGGCTAATAATAAAATGTGCAATCCAGGAATGTGCTCG
ATGCCCGGCACTTGCTGTGGACCGACTGGCGGACTGGGACCCTGCCTGCT
CTGCGGACCCTACAATGGCCAGTGGTTCCGTTCGGTCAACCACTGTTGCG
GTCCTTGTGGCCCATATGGTTGCTGCTCATGCTACGGGCCGTATGGTGGA
CATTGTTAGCCTGCTTAGAAGGAATGTAGGGTTTCTTTATCCGCGATCTG
GAACAGGAGCTTTAAAGATTGCAGCCGTGAGGCCTTGTCGAAGATGAGGA
GCCACGCTGAAAAGTTGTCAGGCAAAGTGGATCCAAAGATTTGTGTTCGA
TGAAAGATTATGCCATCAGAAATAGATGTTAATAAATTATACGTATAATT
CAAAAAAAAAAAAAAAAAAA
GH21762.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:55:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34168-RA | 589 | CG34168-RA | 115..570 | 1..456 | 2280 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:12:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 16133517..16133897 | 451..71 | 1905 | 100 | Minus |
chr2L | 23010047 | chr2L | 16133965..16134034 | 70..1 | 350 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:02:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:12:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16134709..16135094 | 456..71 | 1930 | 100 | Minus |
2L | 23513712 | 2L | 16135162..16135231 | 70..1 | 350 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16134709..16135094 | 456..71 | 1930 | 100 | Minus |
2L | 23513712 | 2L | 16135162..16135231 | 70..1 | 350 | 100 | Minus |
Blast to na_te.dros performed 2019-03-15 21:12:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3S18 | 6126 | 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). | 5348..5426 | 394..316 | 106 | 62.5 | Minus |
GH21762.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:14:02 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 16133517..16133897 | 71..451 | 100 | <- | Minus |
chr2L | 16133965..16134034 | 1..70 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:51:50 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 1..183 | 77..259 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:42 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 1..183 | 77..259 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:40:06 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 1..183 | 77..259 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:07 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 1..183 | 77..259 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:45:59 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 1..183 | 77..259 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:49 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 7..457 | 1..451 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:42 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 7..457 | 1..451 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:40:06 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 42..492 | 1..451 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:07 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 7..457 | 1..451 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:59 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 42..492 | 1..451 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:02 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16135162..16135231 | 1..70 | 100 | | Minus |
2L | 16134714..16135094 | 71..451 | 100 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:02 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16135162..16135231 | 1..70 | 100 | | Minus |
2L | 16134714..16135094 | 71..451 | 100 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:02 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16135162..16135231 | 1..70 | 100 | | Minus |
2L | 16134714..16135094 | 71..451 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:40:06 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 16134714..16135094 | 71..451 | 100 | <- | Minus |
arm_2L | 16135162..16135231 | 1..70 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:12 Download gff for
GH21762.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16134714..16135094 | 71..451 | 100 | <- | Minus |
2L | 16135162..16135231 | 1..70 | 100 | | Minus |
GH21762.hyp Sequence
Translation from 2 to 346
> GH21762.hyp
ENIYLYDYQISRTENPTSVIRLIIKCAIQECARCPALAVDRLADWDPACS
ADPTMASGSVRSTTVAVLVAHMVAAHATGRMVDIVSLLRRNVGFLYPRSG
TGALKIAAVRPCRR*
Sequence GH21762.hyp has no blast hits.
GH21762.pep Sequence
Translation from 76 to 258
> GH21762.pep
MCNPGMCSMPGTCCGPTGGLGPCLLCGPYNGQWFRSVNHCCGPCGPYGCC
SCYGPYGGHC*
GH21762.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:36:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14962-PA | 63 | GF14962-PA | 4..63 | 1..60 | 262 | 90 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34168-PA | 60 | CG34168-PA | 1..60 | 1..60 | 399 | 100 | Plus |
Mst84Da-PA | 63 | CG17946-PA | 6..57 | 3..60 | 134 | 46.6 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:36:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL21273-PA | 60 | GL21273-PA | 1..60 | 1..60 | 264 | 93.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:36:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA18555-PA | 60 | GA18555-PA | 1..60 | 1..60 | 264 | 93.3 | Plus |
Dpse\GA25906-PA | 72 | GA25906-PA | 16..72 | 3..60 | 160 | 62.9 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:36:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK18109-PA | 60 | GK18109-PA | 1..60 | 1..60 | 201 | 88.3 | Plus |