Clone GH21870 Report

Search the DGRC for GH21870

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:218
Well:70
Vector:pOT2
Associated Gene/Transcriptlectin-46Ca-RA
Protein status:GH21870.pep: gold
Preliminary Size:1181
Sequenced Size:1124

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1656 2001-01-01 Release 2 assignment
CG1656 2002-06-12 Blastp of sequenced clone
CG1656 2003-01-01 Sim4 clustering to Release 3
lectin-46Ca 2008-04-29 Release 5.5 accounting
lectin-46Ca 2008-08-15 Release 5.9 accounting
lectin-46Ca 2008-12-18 5.12 accounting

Clone Sequence Records

GH21870.complete Sequence

1124 bp (1124 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122126

> GH21870.complete
CCTCAGTTTTGCTGGCAGCCATGAGGATCCTACCAATTGTGATTCTGACC
TTGATGACGGTCCATTCCGGCTGCGGAAAGAAGCAGAGCAAGAAGGAAAA
GGACAAGGGTCCCTGTGGCAAACCGTATCTCAGGGAGCTAAACGGAAAGT
GCTTCTATGTGGGCATCAAAAAGATCAACTGGTTCGGGGCCCAGAACAAC
TGCCTGCGCAAGGGCCTCAACCTGGCCGACGTGTCCACGATGGAGGACTT
CAAGGCGGTGGTACACTACGTGACGTCACAGGTGGGCTTCGATGACTTCT
GGTTCGGTGGCAACGATCTGCAGTCGGAGGGGCGCTTCAAGTACATCAGC
AGCGGTAAACTGGTGCGCTACATGGGCGACTCCAATATTGTGGAGCCGAC
TCAACGATCCAACCTGGACGACTGCCTGGAGATCAGGATCAGGCCCAATG
TCACCGTCGTCCTGGACGTGAACTGCCAGGAGAAGAAGTACTTCATCTGC
GAACAGAACCAGATGAAGTGCGCCGTTCCCGCCGAGGACAGTGGGGATGG
CCAGAAACACAGCCACGAGCACTTGCATCACTTCCACCACGACGCGGGCC
AGAAGGATAAGCAAGAGACGGGGATCAAAGAGCAAAGTGTGGAGAGCGAT
TCACGGCCAGCTGACAATTCGAATTCAACGGAAATCGGGGTCTCGAAGGA
GAAGGAAGCGGAGGGCGCGCCGACTCCAGGTGATGGTGGTGGCACCACGG
AGCCCGTGTTCGAGAATGGCATGGAAAACGCCGCGGAACCCATTGCCGAG
CAGGAGCAAACGGTGCCGCCAGGCGGCACGGGTCCACCCGCGGCGGCAGA
CGCAACTGGAGCAGCCACGCCCGCACCGGATGCCGCGGCAGCGGAAGGAG
CCACTCCGGCGGCAGCTCCACCAGCGGAAGGAGCTCCAGCCGCCGAGGCC
GCCACTCCTGCACCAGCAGCTCCCGAGGGCGAAGCAACACCAGCTCCGGC
GGCCTGAACGCACGGACCCACCACCAAACGGGCGGACCAATGGACATTTA
GGGAACCGAGGAATATTTGAGCTTTCACCAAATAAATTTGAGTTTTAACA
ACATGAAAAAAAAAAAAAAAAAAA

GH21870.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-46Ca.a 1429 lectin-46Ca.a 224..1330 1..1107 5535 100 Plus
lectin-46Ca-RA 1206 lectin-46Ca-RA 1..1107 1..1107 5535 100 Plus
lectin-46Cb-RA 1472 lectin-46Cb-RA 700..774 297..371 180 82.6 Plus
lectin-46Cb-RA 1472 lectin-46Cb-RA 952..987 558..593 165 97.2 Plus
lectin-46Cb-RA 1472 lectin-46Cb-RA 571..633 168..230 165 84.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5705062..5705995 172..1105 4670 100 Plus
chr2R 21145070 chr2R 5704760..5704932 1..173 865 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:02:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9817602..9818537 172..1107 4680 100 Plus
2R 25286936 2R 9817300..9817472 1..173 865 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9818801..9819736 172..1107 4680 100 Plus
2R 25260384 2R 9818499..9818671 1..173 865 100 Plus
2R 25260384 2R 9817027..9817101 297..371 180 82.6 Plus
2R 25260384 2R 9817279..9817314 558..593 165 97.2 Plus
2R 25260384 2R 9816902..9816960 172..230 145 83 Plus
Blast to na_te.dros performed 2019-03-16 17:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6902 847..1028 196 58.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2766..2913 841..994 153 57.8 Plus

GH21870.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:46:19 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5704760..5704932 1..173 100 -> Plus
chr2R 5705064..5705995 174..1105 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:51:55 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-46Ca-RA 1..987 21..1007 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:23:17 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-46Ca-RA 1..987 21..1007 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:00:52 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-46Ca-RA 1..987 21..1007 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:13:59 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-46Ca-RA 1..987 21..1007 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:05:55 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-46Ca-RA 1..987 21..1007 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:50:18 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-46Ca-RA 1..1105 1..1105 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:23:16 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-46Ca-RA 1..1105 1..1105 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:00:52 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-46Ca-RA 1..1105 1..1105 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:14:00 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-46Ca-RA 1..1105 1..1105 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:05:55 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-46Ca-RA 1..1105 1..1105 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:46:19 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9817300..9817472 1..173 100 -> Plus
2R 9817604..9818535 174..1105 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:46:19 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9817300..9817472 1..173 100 -> Plus
2R 9817604..9818535 174..1105 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:46:19 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9817300..9817472 1..173 100 -> Plus
2R 9817604..9818535 174..1105 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:00:52 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5704805..5704977 1..173 100 -> Plus
arm_2R 5705109..5706040 174..1105 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:46:52 Download gff for GH21870.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9818803..9819734 174..1105 100   Plus
2R 9818499..9818671 1..173 100 -> Plus

GH21870.hyp Sequence

Translation from 2 to 1006

> GH21870.hyp
SVLLAAMRILPIVILTLMTVHSGCGKKQSKKEKDKGPCGKPYLRELNGKC
FYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFW
FGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNV
TVVLDVNCQEKKYFICEQNQMKCAVPAEDSGDGQKHSHEHLHHFHHDAGQ
KDKQETGIKEQSVESDSRPADNSNSTEIGVSKEKEAEGAPTPGDGGGTTE
PVFENGMENAAEPIAEQEQTVPPGGTGPPAAADATGAATPAPDAAAAEGA
TPAAAPPAEGAPAAEAATPAPAAPEGEATPAPAA*

GH21870.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-46Ca-PA 328 CG1656-PA 1..328 7..334 1748 100 Plus
lectin-46Cb-PB 322 CG1652-PB 26..313 37..334 613 46.9 Plus
Tm1-PF 501 CG4898-PF 348..461 219..334 167 45.5 Plus
CG9134-PC 188 CG9134-PC 54..184 43..167 149 30.3 Plus
CG9134-PA 188 CG9134-PA 54..184 43..167 149 30.3 Plus

GH21870.pep Sequence

Translation from 20 to 1006

> GH21870.pep
MRILPIVILTLMTVHSGCGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIK
KINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDL
QSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDV
NCQEKKYFICEQNQMKCAVPAEDSGDGQKHSHEHLHHFHHDAGQKDKQET
GIKEQSVESDSRPADNSNSTEIGVSKEKEAEGAPTPGDGGGTTEPVFENG
MENAAEPIAEQEQTVPPGGTGPPAAADATGAATPAPDAAAAEGATPAAAP
PAEGAPAAEAATPAPAAPEGEATPAPAA*

GH21870.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13388-PA 323 GF13388-PA 1..322 1..301 777 55.6 Plus
Dana\GF13387-PA 298 GF13387-PA 27..157 32..162 444 54.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24105-PA 326 GG24105-PA 1..265 1..265 1101 85.3 Plus
Dere\GG24104-PA 321 GG24104-PA 26..168 31..179 446 51.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-46Ca-PA 328 CG1656-PA 1..328 1..328 1748 100 Plus
lectin-46Cb-PB 322 CG1652-PB 26..313 31..328 613 46.9 Plus
Tm1-PF 501 CG4898-PF 348..461 213..328 167 45.5 Plus
tfc-PC 188 CG9134-PC 54..184 37..161 149 30.3 Plus
tfc-PA 188 CG9134-PA 54..184 37..161 149 30.3 Plus
CG12111-PB 188 CG12111-PB 47..179 35..166 146 25.7 Plus
CG12111-PA 188 CG12111-PA 47..179 35..166 146 25.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18432-PA 356 GI18432-PA 1..257 1..271 649 49.8 Plus
Dmoj\GI18431-PA 363 GI18431-PA 11..164 3..162 459 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17024-PA 457 GL17024-PA 1..230 1..225 680 58 Plus
Dper\GL17023-PA 559 GL17023-PA 28..179 32..185 479 54.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24335-PB 590 GA24335-PB 1..269 1..263 702 53.7 Plus
Dpse\GA14075-PA 577 GA14075-PA 28..179 32..185 481 54.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21153-PA 329 GM21153-PA 1..329 1..328 1266 91.8 Plus
Dsec\GM21152-PA 322 GM21152-PA 26..157 31..162 431 53.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\lectin-46Ca-PA 329 GD10685-PA 1..329 1..328 1687 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21515-PA 390 GJ21515-PA 1..231 1..221 630 58.4 Plus
Dvir\GJ21514-PA 406 GJ21514-PA 1..245 1..250 487 44.5 Plus
Dvir\GJ24063-PA 173 GJ24063-PA 37..168 38..167 147 28.4 Plus
Dvir\GJ11333-PA 226 GJ11333-PA 85..225 24..162 146 28.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15959-PA 358 GK15959-PA 1..254 1..264 665 53.7 Plus
Dwil\GK15958-PA 349 GK15958-PA 27..158 32..163 447 53 Plus
Dwil\GK23834-PA 184 GK23834-PA 6..120 3..113 145 28.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19303-PA 326 GE19303-PA 1..316 1..320 1147 82.2 Plus
Dyak\GE19302-PA 318 GE19302-PA 26..168 31..179 435 51 Plus