BDGP Sequence Production Resources |
Search the DGRC for GH21870
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 218 |
Well: | 70 |
Vector: | pOT2 |
Associated Gene/Transcript | lectin-46Ca-RA |
Protein status: | GH21870.pep: gold |
Preliminary Size: | 1181 |
Sequenced Size: | 1124 |
Gene | Date | Evidence |
---|---|---|
CG1656 | 2001-01-01 | Release 2 assignment |
CG1656 | 2002-06-12 | Blastp of sequenced clone |
CG1656 | 2003-01-01 | Sim4 clustering to Release 3 |
lectin-46Ca | 2008-04-29 | Release 5.5 accounting |
lectin-46Ca | 2008-08-15 | Release 5.9 accounting |
lectin-46Ca | 2008-12-18 | 5.12 accounting |
1124 bp (1124 high quality bases) assembled on 2002-06-12
GenBank Submission: AY122126
> GH21870.complete CCTCAGTTTTGCTGGCAGCCATGAGGATCCTACCAATTGTGATTCTGACC TTGATGACGGTCCATTCCGGCTGCGGAAAGAAGCAGAGCAAGAAGGAAAA GGACAAGGGTCCCTGTGGCAAACCGTATCTCAGGGAGCTAAACGGAAAGT GCTTCTATGTGGGCATCAAAAAGATCAACTGGTTCGGGGCCCAGAACAAC TGCCTGCGCAAGGGCCTCAACCTGGCCGACGTGTCCACGATGGAGGACTT CAAGGCGGTGGTACACTACGTGACGTCACAGGTGGGCTTCGATGACTTCT GGTTCGGTGGCAACGATCTGCAGTCGGAGGGGCGCTTCAAGTACATCAGC AGCGGTAAACTGGTGCGCTACATGGGCGACTCCAATATTGTGGAGCCGAC TCAACGATCCAACCTGGACGACTGCCTGGAGATCAGGATCAGGCCCAATG TCACCGTCGTCCTGGACGTGAACTGCCAGGAGAAGAAGTACTTCATCTGC GAACAGAACCAGATGAAGTGCGCCGTTCCCGCCGAGGACAGTGGGGATGG CCAGAAACACAGCCACGAGCACTTGCATCACTTCCACCACGACGCGGGCC AGAAGGATAAGCAAGAGACGGGGATCAAAGAGCAAAGTGTGGAGAGCGAT TCACGGCCAGCTGACAATTCGAATTCAACGGAAATCGGGGTCTCGAAGGA GAAGGAAGCGGAGGGCGCGCCGACTCCAGGTGATGGTGGTGGCACCACGG AGCCCGTGTTCGAGAATGGCATGGAAAACGCCGCGGAACCCATTGCCGAG CAGGAGCAAACGGTGCCGCCAGGCGGCACGGGTCCACCCGCGGCGGCAGA CGCAACTGGAGCAGCCACGCCCGCACCGGATGCCGCGGCAGCGGAAGGAG CCACTCCGGCGGCAGCTCCACCAGCGGAAGGAGCTCCAGCCGCCGAGGCC GCCACTCCTGCACCAGCAGCTCCCGAGGGCGAAGCAACACCAGCTCCGGC GGCCTGAACGCACGGACCCACCACCAAACGGGCGGACCAATGGACATTTA GGGAACCGAGGAATATTTGAGCTTTCACCAAATAAATTTGAGTTTTAACA ACATGAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
lectin-46Ca.a | 1429 | lectin-46Ca.a | 224..1330 | 1..1107 | 5535 | 100 | Plus |
lectin-46Ca-RA | 1206 | lectin-46Ca-RA | 1..1107 | 1..1107 | 5535 | 100 | Plus |
lectin-46Cb-RA | 1472 | lectin-46Cb-RA | 700..774 | 297..371 | 180 | 82.6 | Plus |
lectin-46Cb-RA | 1472 | lectin-46Cb-RA | 952..987 | 558..593 | 165 | 97.2 | Plus |
lectin-46Cb-RA | 1472 | lectin-46Cb-RA | 571..633 | 168..230 | 165 | 84.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 9818801..9819736 | 172..1107 | 4680 | 100 | Plus |
2R | 25260384 | 2R | 9818499..9818671 | 1..173 | 865 | 100 | Plus |
2R | 25260384 | 2R | 9817027..9817101 | 297..371 | 180 | 82.6 | Plus |
2R | 25260384 | 2R | 9817279..9817314 | 558..593 | 165 | 97.2 | Plus |
2R | 25260384 | 2R | 9816902..9816960 | 172..230 | 145 | 83 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 5704760..5704932 | 1..173 | 100 | -> | Plus |
chr2R | 5705064..5705995 | 174..1105 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Ca-RA | 1..987 | 21..1007 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Ca-RA | 1..987 | 21..1007 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Ca-RA | 1..987 | 21..1007 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Ca-RA | 1..987 | 21..1007 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Ca-RA | 1..987 | 21..1007 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Ca-RA | 1..1105 | 1..1105 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Ca-RA | 1..1105 | 1..1105 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Ca-RA | 1..1105 | 1..1105 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Ca-RA | 1..1105 | 1..1105 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Ca-RA | 1..1105 | 1..1105 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9817300..9817472 | 1..173 | 100 | -> | Plus |
2R | 9817604..9818535 | 174..1105 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9817300..9817472 | 1..173 | 100 | -> | Plus |
2R | 9817604..9818535 | 174..1105 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9817300..9817472 | 1..173 | 100 | -> | Plus |
2R | 9817604..9818535 | 174..1105 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 5704805..5704977 | 1..173 | 100 | -> | Plus |
arm_2R | 5705109..5706040 | 174..1105 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9818803..9819734 | 174..1105 | 100 | Plus | |
2R | 9818499..9818671 | 1..173 | 100 | -> | Plus |
Translation from 2 to 1006
> GH21870.hyp SVLLAAMRILPIVILTLMTVHSGCGKKQSKKEKDKGPCGKPYLRELNGKC FYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFW FGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNV TVVLDVNCQEKKYFICEQNQMKCAVPAEDSGDGQKHSHEHLHHFHHDAGQ KDKQETGIKEQSVESDSRPADNSNSTEIGVSKEKEAEGAPTPGDGGGTTE PVFENGMENAAEPIAEQEQTVPPGGTGPPAAADATGAATPAPDAAAAEGA TPAAAPPAEGAPAAEAATPAPAAPEGEATPAPAA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
lectin-46Ca-PA | 328 | CG1656-PA | 1..328 | 7..334 | 1748 | 100 | Plus |
lectin-46Cb-PB | 322 | CG1652-PB | 26..313 | 37..334 | 613 | 46.9 | Plus |
Tm1-PF | 501 | CG4898-PF | 348..461 | 219..334 | 167 | 45.5 | Plus |
CG9134-PC | 188 | CG9134-PC | 54..184 | 43..167 | 149 | 30.3 | Plus |
CG9134-PA | 188 | CG9134-PA | 54..184 | 43..167 | 149 | 30.3 | Plus |
Translation from 20 to 1006
> GH21870.pep MRILPIVILTLMTVHSGCGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIK KINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDL QSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDV NCQEKKYFICEQNQMKCAVPAEDSGDGQKHSHEHLHHFHHDAGQKDKQET GIKEQSVESDSRPADNSNSTEIGVSKEKEAEGAPTPGDGGGTTEPVFENG MENAAEPIAEQEQTVPPGGTGPPAAADATGAATPAPDAAAAEGATPAAAP PAEGAPAAEAATPAPAAPEGEATPAPAA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13388-PA | 323 | GF13388-PA | 1..322 | 1..301 | 777 | 55.6 | Plus |
Dana\GF13387-PA | 298 | GF13387-PA | 27..157 | 32..162 | 444 | 54.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24105-PA | 326 | GG24105-PA | 1..265 | 1..265 | 1101 | 85.3 | Plus |
Dere\GG24104-PA | 321 | GG24104-PA | 26..168 | 31..179 | 446 | 51.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
lectin-46Ca-PA | 328 | CG1656-PA | 1..328 | 1..328 | 1748 | 100 | Plus |
lectin-46Cb-PB | 322 | CG1652-PB | 26..313 | 31..328 | 613 | 46.9 | Plus |
Tm1-PF | 501 | CG4898-PF | 348..461 | 213..328 | 167 | 45.5 | Plus |
tfc-PC | 188 | CG9134-PC | 54..184 | 37..161 | 149 | 30.3 | Plus |
tfc-PA | 188 | CG9134-PA | 54..184 | 37..161 | 149 | 30.3 | Plus |
CG12111-PB | 188 | CG12111-PB | 47..179 | 35..166 | 146 | 25.7 | Plus |
CG12111-PA | 188 | CG12111-PA | 47..179 | 35..166 | 146 | 25.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18432-PA | 356 | GI18432-PA | 1..257 | 1..271 | 649 | 49.8 | Plus |
Dmoj\GI18431-PA | 363 | GI18431-PA | 11..164 | 3..162 | 459 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17024-PA | 457 | GL17024-PA | 1..230 | 1..225 | 680 | 58 | Plus |
Dper\GL17023-PA | 559 | GL17023-PA | 28..179 | 32..185 | 479 | 54.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24335-PB | 590 | GA24335-PB | 1..269 | 1..263 | 702 | 53.7 | Plus |
Dpse\GA14075-PA | 577 | GA14075-PA | 28..179 | 32..185 | 481 | 54.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21153-PA | 329 | GM21153-PA | 1..329 | 1..328 | 1266 | 91.8 | Plus |
Dsec\GM21152-PA | 322 | GM21152-PA | 26..157 | 31..162 | 431 | 53.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\lectin-46Ca-PA | 329 | GD10685-PA | 1..329 | 1..328 | 1687 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21515-PA | 390 | GJ21515-PA | 1..231 | 1..221 | 630 | 58.4 | Plus |
Dvir\GJ21514-PA | 406 | GJ21514-PA | 1..245 | 1..250 | 487 | 44.5 | Plus |
Dvir\GJ24063-PA | 173 | GJ24063-PA | 37..168 | 38..167 | 147 | 28.4 | Plus |
Dvir\GJ11333-PA | 226 | GJ11333-PA | 85..225 | 24..162 | 146 | 28.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15959-PA | 358 | GK15959-PA | 1..254 | 1..264 | 665 | 53.7 | Plus |
Dwil\GK15958-PA | 349 | GK15958-PA | 27..158 | 32..163 | 447 | 53 | Plus |
Dwil\GK23834-PA | 184 | GK23834-PA | 6..120 | 3..113 | 145 | 28.4 | Plus |