Clone GH22047 Report

Search the DGRC for GH22047

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:220
Well:47
Vector:pOT2
Associated Gene/TranscriptNpc2a-RA
Protein status:GH22047.pep: gold
Preliminary Size:637
Sequenced Size:677

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7291 2002-01-01 Sim4 clustering to Release 2
CG7291 2002-05-18 Blastp of sequenced clone
CG7291 2003-01-01 Sim4 clustering to Release 3
NPC2 2008-04-29 Release 5.5 accounting
NPC2 2008-08-15 Release 5.9 accounting
NPC2 2008-12-18 5.12 accounting

Clone Sequence Records

GH22047.complete Sequence

677 bp (677 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118810

> GH22047.complete
AGATTTAGTAGATTCGTAGCGCTGTGAAGAGGCAGAAAGAGGCGAGAGCC
AGCGGAAAAGCCACCCGATACGTTTACCTTGTAATTCAATTAAGTGGAAG
AAAATGCTGAGGTACGCGGTAATTGCCTGTGCTGCACTGGTGGTCTTCGC
CGGAGCCCTCGAGTTCAGCGATTGCGGATCGAAGACGGGCAAGTTCACCC
GGGTGGCCATCGAGGGCTGCGACACCACCAAGGCGGAGTGCATCCTCAAG
AGGAACACCACGGTCAGCTTCTCCATCGACTTCGCCCTGGCCGAGGAGGC
AACGGCGGTGAAGACAGTCGTCCACGGCAAGGTCCTGGGCATCGAGATGC
CCTTCCCGCTGGCCAATCCCGATGCCTGTGTGGACAGTGGTCTGAAGTGC
CCGTTGGAGAAGGACGAGTCGTACCGCTACACGGCCACCCTGCCGGTGCT
GAGATCCTACCCCAAAGTGTCCGTGCTGGTCAAGTGGGAGCTGCAGGATC
AGGACGGAGCGGACATCATCTGCGTCGAGATTCCCGCTAAAATTCAGTAG
GCAGTCACCCTCTAAATTAACCTCGAAATACTGGGGAGAGCGCACTGAGC
ACTCCTGATTTTCCTCTCCATTGTAATCTAATTTAAAATAAATAAATTTA
CACTTAAAAAAAAAAAAAAAAAAAAAA

GH22047.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2a-RA 664 Npc2a-RA 1..657 1..657 3285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1988037..1988691 1..655 3275 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:02:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1988286..1988942 1..657 3285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1988286..1988942 1..657 3285 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:39:30 has no hits.

GH22047.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:40:31 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1988037..1988663 1..627 100 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:52:09 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
NPC2-RA 1..447 104..550 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:45:59 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2a-RA 1..447 104..550 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:42:34 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2a-RA 1..447 104..550 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:15 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
NPC2-RA 1..447 104..550 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:43:28 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2a-RA 1..447 104..550 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:21:29 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
NPC2-RA 1..650 6..655 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:45:59 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2a-RA 1..649 7..655 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:42:34 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2a-RA 1..651 5..655 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:16 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
NPC2-RA 1..650 6..655 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:43:28 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2a-RA 1..651 5..655 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:31 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1988286..1988940 1..655 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:31 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1988286..1988940 1..655 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:31 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1988286..1988940 1..655 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:42:34 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1988286..1988940 1..655 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:37 Download gff for GH22047.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1988286..1988940 1..655 100   Plus

GH22047.pep Sequence

Translation from 103 to 549

> GH22047.pep
MLRYAVIACAALVVFAGALEFSDCGSKTGKFTRVAIEGCDTTKAECILKR
NTTVSFSIDFALAEEATAVKTVVHGKVLGIEMPFPLANPDACVDSGLKCP
LEKDESYRYTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPAKIQ*

GH22047.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14593-PA 148 GF14593-PA 1..148 1..148 721 91.9 Plus
Dana\GF16235-PA 162 GF16235-PA 13..161 9..148 175 34.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24820-PA 148 GG24820-PA 1..148 1..148 748 97.3 Plus
Dere\GG16835-PA 159 GG16835-PA 12..158 10..148 179 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25210-PA 150 GH25210-PA 22..150 20..148 597 82.9 Plus
Dgri\GH25061-PA 160 GH25061-PA 9..159 6..148 182 33.8 Plus
Dgri\GH22453-PA 160 GH22453-PA 9..159 6..148 182 33.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2a-PA 148 CG7291-PA 1..148 1..148 762 100 Plus
Npc2b-PA 159 CG3153-PA 12..158 10..148 178 32.7 Plus
Npc2b-PB 159 CG3153-PB 12..158 10..148 178 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18242-PA 150 GI18242-PA 17..150 15..148 602 80.6 Plus
Dmoj\GI17283-PA 150 GI17283-PA 18..150 16..148 584 79.7 Plus
Dmoj\GI23038-PA 159 GI23038-PA 8..158 6..148 183 31.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19668-PA 147 GL19668-PA 1..147 1..148 669 85.1 Plus
Dper\GL24236-PA 159 GL24236-PA 9..158 7..148 184 32.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20242-PA 147 GA20242-PA 1..147 1..148 669 85.1 Plus
Dpse\GA16304-PA 159 GA16304-PA 9..158 7..148 181 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16844-PA 70 GM16844-PA 1..40 82..121 195 87.5 Plus
Dsec\GM24149-PA 159 GM24149-PA 12..158 10..148 179 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23124-PA 148 GD23124-PA 1..148 1..148 753 96.6 Plus
Dsim\GD18945-PA 159 GD18945-PA 12..158 10..148 181 33.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22897-PA 150 GJ22897-PA 1..150 1..148 611 74 Plus
Dvir\GJ24627-PA 157 GJ24627-PA 37..156 34..148 172 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24197-PA 149 GK24197-PA 13..149 12..148 649 88.3 Plus
Dwil\GK12189-PA 160 GK12189-PA 8..159 6..148 173 31 Plus
Dwil\GK12205-PA 172 GK12205-PA 25..149 18..140 134 32 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17856-PA 148 GE17856-PA 1..148 1..148 752 97.3 Plus
Dyak\GE24217-PA 159 GE24217-PA 12..158 10..148 178 33.3 Plus

GH22047.hyp Sequence

Translation from 103 to 549

> GH22047.hyp
MLRYAVIACAALVVFAGALEFSDCGSKTGKFTRVAIEGCDTTKAECILKR
NTTVSFSIDFALAEEATAVKTVVHGKVLGIEMPFPLANPDACVDSGLKCP
LEKDESYRYTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPAKIQ*

GH22047.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2a-PA 148 CG7291-PA 1..148 1..148 762 100 Plus
Npc2b-PA 159 CG3153-PA 12..158 10..148 178 32.7 Plus
Npc2b-PB 159 CG3153-PB 12..158 10..148 178 32.7 Plus