![]() | BDGP Sequence Production Resources |
Search the DGRC for GH22047
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 220 |
Well: | 47 |
Vector: | pOT2 |
Associated Gene/Transcript | Npc2a-RA |
Protein status: | GH22047.pep: gold |
Preliminary Size: | 637 |
Sequenced Size: | 677 |
Gene | Date | Evidence |
---|---|---|
CG7291 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7291 | 2002-05-18 | Blastp of sequenced clone |
CG7291 | 2003-01-01 | Sim4 clustering to Release 3 |
NPC2 | 2008-04-29 | Release 5.5 accounting |
NPC2 | 2008-08-15 | Release 5.9 accounting |
NPC2 | 2008-12-18 | 5.12 accounting |
677 bp (677 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118810
> GH22047.complete AGATTTAGTAGATTCGTAGCGCTGTGAAGAGGCAGAAAGAGGCGAGAGCC AGCGGAAAAGCCACCCGATACGTTTACCTTGTAATTCAATTAAGTGGAAG AAAATGCTGAGGTACGCGGTAATTGCCTGTGCTGCACTGGTGGTCTTCGC CGGAGCCCTCGAGTTCAGCGATTGCGGATCGAAGACGGGCAAGTTCACCC GGGTGGCCATCGAGGGCTGCGACACCACCAAGGCGGAGTGCATCCTCAAG AGGAACACCACGGTCAGCTTCTCCATCGACTTCGCCCTGGCCGAGGAGGC AACGGCGGTGAAGACAGTCGTCCACGGCAAGGTCCTGGGCATCGAGATGC CCTTCCCGCTGGCCAATCCCGATGCCTGTGTGGACAGTGGTCTGAAGTGC CCGTTGGAGAAGGACGAGTCGTACCGCTACACGGCCACCCTGCCGGTGCT GAGATCCTACCCCAAAGTGTCCGTGCTGGTCAAGTGGGAGCTGCAGGATC AGGACGGAGCGGACATCATCTGCGTCGAGATTCCCGCTAAAATTCAGTAG GCAGTCACCCTCTAAATTAACCTCGAAATACTGGGGAGAGCGCACTGAGC ACTCCTGATTTTCCTCTCCATTGTAATCTAATTTAAAATAAATAAATTTA CACTTAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2a-RA | 664 | Npc2a-RA | 1..657 | 1..657 | 3285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 1988037..1988691 | 1..655 | 3275 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 1988286..1988942 | 1..657 | 3285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 1988286..1988942 | 1..657 | 3285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 1988037..1988663 | 1..627 | 100 | <- | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NPC2-RA | 1..447 | 104..550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2a-RA | 1..447 | 104..550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2a-RA | 1..447 | 104..550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NPC2-RA | 1..447 | 104..550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2a-RA | 1..447 | 104..550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NPC2-RA | 1..650 | 6..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2a-RA | 1..649 | 7..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2a-RA | 1..651 | 5..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NPC2-RA | 1..650 | 6..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2a-RA | 1..651 | 5..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1988286..1988940 | 1..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1988286..1988940 | 1..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1988286..1988940 | 1..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 1988286..1988940 | 1..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1988286..1988940 | 1..655 | 100 | Plus |
Translation from 103 to 549
> GH22047.pep MLRYAVIACAALVVFAGALEFSDCGSKTGKFTRVAIEGCDTTKAECILKR NTTVSFSIDFALAEEATAVKTVVHGKVLGIEMPFPLANPDACVDSGLKCP LEKDESYRYTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPAKIQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14593-PA | 148 | GF14593-PA | 1..148 | 1..148 | 721 | 91.9 | Plus |
Dana\GF16235-PA | 162 | GF16235-PA | 13..161 | 9..148 | 175 | 34.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24820-PA | 148 | GG24820-PA | 1..148 | 1..148 | 748 | 97.3 | Plus |
Dere\GG16835-PA | 159 | GG16835-PA | 12..158 | 10..148 | 179 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH25210-PA | 150 | GH25210-PA | 22..150 | 20..148 | 597 | 82.9 | Plus |
Dgri\GH25061-PA | 160 | GH25061-PA | 9..159 | 6..148 | 182 | 33.8 | Plus |
Dgri\GH22453-PA | 160 | GH22453-PA | 9..159 | 6..148 | 182 | 33.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2a-PA | 148 | CG7291-PA | 1..148 | 1..148 | 762 | 100 | Plus |
Npc2b-PA | 159 | CG3153-PA | 12..158 | 10..148 | 178 | 32.7 | Plus |
Npc2b-PB | 159 | CG3153-PB | 12..158 | 10..148 | 178 | 32.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18242-PA | 150 | GI18242-PA | 17..150 | 15..148 | 602 | 80.6 | Plus |
Dmoj\GI17283-PA | 150 | GI17283-PA | 18..150 | 16..148 | 584 | 79.7 | Plus |
Dmoj\GI23038-PA | 159 | GI23038-PA | 8..158 | 6..148 | 183 | 31.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19668-PA | 147 | GL19668-PA | 1..147 | 1..148 | 669 | 85.1 | Plus |
Dper\GL24236-PA | 159 | GL24236-PA | 9..158 | 7..148 | 184 | 32.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20242-PA | 147 | GA20242-PA | 1..147 | 1..148 | 669 | 85.1 | Plus |
Dpse\GA16304-PA | 159 | GA16304-PA | 9..158 | 7..148 | 181 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16844-PA | 70 | GM16844-PA | 1..40 | 82..121 | 195 | 87.5 | Plus |
Dsec\GM24149-PA | 159 | GM24149-PA | 12..158 | 10..148 | 179 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23124-PA | 148 | GD23124-PA | 1..148 | 1..148 | 753 | 96.6 | Plus |
Dsim\GD18945-PA | 159 | GD18945-PA | 12..158 | 10..148 | 181 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22897-PA | 150 | GJ22897-PA | 1..150 | 1..148 | 611 | 74 | Plus |
Dvir\GJ24627-PA | 157 | GJ24627-PA | 37..156 | 34..148 | 172 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24197-PA | 149 | GK24197-PA | 13..149 | 12..148 | 649 | 88.3 | Plus |
Dwil\GK12189-PA | 160 | GK12189-PA | 8..159 | 6..148 | 173 | 31 | Plus |
Dwil\GK12205-PA | 172 | GK12205-PA | 25..149 | 18..140 | 134 | 32 | Plus |
Translation from 103 to 549
> GH22047.hyp MLRYAVIACAALVVFAGALEFSDCGSKTGKFTRVAIEGCDTTKAECILKR NTTVSFSIDFALAEEATAVKTVVHGKVLGIEMPFPLANPDACVDSGLKCP LEKDESYRYTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPAKIQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2a-PA | 148 | CG7291-PA | 1..148 | 1..148 | 762 | 100 | Plus |
Npc2b-PA | 159 | CG3153-PA | 12..158 | 10..148 | 178 | 32.7 | Plus |
Npc2b-PB | 159 | CG3153-PB | 12..158 | 10..148 | 178 | 32.7 | Plus |