Clone GH22096 Report

Search the DGRC for GH22096

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:220
Well:96
Vector:pOT2
Associated Gene/TranscriptCG6984-RA
Protein status:GH22096.pep: gold
Preliminary Size:1108
Sequenced Size:1022

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6984 2001-01-01 Release 2 assignment
CG6984 2003-01-01 Sim4 clustering to Release 3
CG6984 2003-02-17 Blastp of sequenced clone
CG6984 2008-04-29 Release 5.5 accounting
CG6984 2008-08-15 Release 5.9 accounting
CG6984 2008-12-18 5.12 accounting

Clone Sequence Records

GH22096.complete Sequence

1022 bp (1022 high quality bases) assembled on 2003-02-17

GenBank Submission: AY069175

> GH22096.complete
AAAATGTTGCGTATTTTAAACAACTCCTTAAAAATATCAAAATATGCAAC
AGGTTGCGTGCAACAGGTCATTCGCTTTACCAGCAATGGACCCAGTGATT
TGGTCCTGGTCAAGGAGCATAACGGAGTGCGAGAGATAACGCTGAATCAT
CCAAAAACTCTGAATTCCCTATCACTGGACATGATGTGTGCCCTTCAGGA
CGCCCTGCTAAAAGATAAAGACAACTTGGATCTGAGATGCGTGGTCCTGA
CGGCCCAAGGAAAGATCTGGTCGGCAGGTCACAATCTCAAGGAGTTGCAC
AATGACCCCAAGATACAGGCTTGTGTGTTCCAGAAGCTAACCGATGTTAT
AAACGACATCCAAAGACTGCCGGTGCCCGTACTAGGAAAAGTCAATGGCT
ATGCGGCTGCTGCAGGCTGCCAACTGGTGGTGTCATGTGACATGGTAGTC
TGCACCAAGAACAGCAAGTTCTCTACTCCAGGGGCTGGAGTCGGAGTTTT
TTGCTCAACACCCGGAGTCGCAGTTGCCCGGATTATGTCGCGTCCAAAGT
CCGCCTATATGCTAATGACCGGTCTTCCCGTTACTGGTGAAGAAGCCTAC
ATATCGGGAATGGTCACCAAAGCTGTTCCTGCAGAGGAACTAGATAAGGA
GATCGAGGAAATCACCAATGCCATAAAGGCAAAAAGTCGTGCCGTCATCT
CTCTGGGAAAAGAGTTCTACTACAAGCAACTGGCCATGTCCCAAGCGGAA
GCCTTTTCGGCTGCGCAGGAGAAGATGTGCGAAAATTTCCAGCTGGGCGA
CACCAAAGAGGGCATTGCTAGCTTCTTCGAGAAGCGCCCACCCAACTGGA
AGCACCAGTAACCGCAACATACAATATGAAATAATGAATCAAAACTGACC
AATTGTGCATTTATACTTTTAAGCTTGAATTGTCCAAAGTGACTTAAAAG
AATGTTAATTTGAAATGTTATTTTTTTAAACGTTTATAAAACAATGTTGA
ACACAAAAAAAAAAAAAAAAAA

GH22096.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6984-RA 1116 CG6984-RA 54..1059 1..1006 5030 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12979753..12980277 482..1004 2500 98.9 Plus
chr2R 21145070 chr2R 12979215..12979697 1..483 2355 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:02:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17092548..17093072 482..1006 2625 100 Plus
2R 25286936 2R 17092010..17092492 1..483 2415 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17093747..17094271 482..1006 2625 100 Plus
2R 25260384 2R 17093209..17093691 1..483 2415 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:40:16 has no hits.

GH22096.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:40:55 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12979215..12979696 1..482 99 -> Plus
chr2R 12979754..12980277 483..1004 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:52:12 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
CG6984-RA 1..858 4..861 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:50:12 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
CG6984-RA 1..858 4..861 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:43:22 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
CG6984-RA 1..858 4..861 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:41:27 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
CG6984-RA 1..858 4..861 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:44:17 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
CG6984-RA 1..858 4..861 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:03:11 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
CG6984-RA 1..1004 1..1004 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:50:12 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
CG6984-RA 1..1004 1..1004 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:43:22 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
CG6984-RA 27..1030 1..1004 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:41:27 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
CG6984-RA 1..1004 1..1004 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:44:17 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
CG6984-RA 27..1030 1..1004 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:55 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17092010..17092491 1..482 100 -> Plus
2R 17092549..17093070 483..1004 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:55 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17092010..17092491 1..482 100 -> Plus
2R 17092549..17093070 483..1004 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:55 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17092010..17092491 1..482 100 -> Plus
2R 17092549..17093070 483..1004 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:43:22 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12979515..12979996 1..482 100 -> Plus
arm_2R 12980054..12980575 483..1004 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:11:59 Download gff for GH22096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17093209..17093690 1..482 100 -> Plus
2R 17093748..17094269 483..1004 100   Plus

GH22096.hyp Sequence

Translation from 0 to 860

> GH22096.hyp
KMLRILNNSLKISKYATGCVQQVIRFTSNGPSDLVLVKEHNGVREITLNH
PKTLNSLSLDMMCALQDALLKDKDNLDLRCVVLTAQGKIWSAGHNLKELH
NDPKIQACVFQKLTDVINDIQRLPVPVLGKVNGYAAAAGCQLVVSCDMVV
CTKNSKFSTPGAGVGVFCSTPGVAVARIMSRPKSAYMLMTGLPVTGEEAY
ISGMVTKAVPAEELDKEIEEITNAIKAKSRAVISLGKEFYYKQLAMSQAE
AFSAAQEKMCENFQLGDTKEGIASFFEKRPPNWKHQ*

GH22096.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG6984-PA 285 CG6984-PA 1..285 2..286 1467 100 Plus
CG6543-PA 295 CG6543-PA 48..295 39..286 297 28.9 Plus
CG6543-PB 295 CG6543-PB 48..295 39..286 297 28.9 Plus
CG8778-PA 299 CG8778-PA 32..297 30..284 185 26.3 Plus

GH22096.pep Sequence

Translation from 3 to 860

> GH22096.pep
MLRILNNSLKISKYATGCVQQVIRFTSNGPSDLVLVKEHNGVREITLNHP
KTLNSLSLDMMCALQDALLKDKDNLDLRCVVLTAQGKIWSAGHNLKELHN
DPKIQACVFQKLTDVINDIQRLPVPVLGKVNGYAAAAGCQLVVSCDMVVC
TKNSKFSTPGAGVGVFCSTPGVAVARIMSRPKSAYMLMTGLPVTGEEAYI
SGMVTKAVPAEELDKEIEEITNAIKAKSRAVISLGKEFYYKQLAMSQAEA
FSAAQEKMCENFQLGDTKEGIASFFEKRPPNWKHQ*

GH22096.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11437-PA 280 GF11437-PA 3..280 5..285 1305 85.8 Plus
Dana\GF11161-PA 293 GF11161-PA 24..293 20..285 295 28.8 Plus
Dana\GF11465-PA 299 GF11465-PA 32..299 29..285 181 26.1 Plus
Dana\GF24414-PA 260 GF24414-PA 9..257 34..278 154 21.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20659-PA 285 GG20659-PA 1..284 1..284 1467 95.4 Plus
Dere\GG22466-PA 294 GG22466-PA 24..294 20..285 304 28.3 Plus
Dere\GG22562-PA 299 GG22562-PA 32..299 29..285 177 26.1 Plus
Dere\GG10065-PA 280 GG10065-PA 28..207 34..212 146 24.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21008-PA 274 GH21008-PA 18..273 23..284 872 64.6 Plus
Dgri\GH20865-PA 293 GH20865-PA 24..293 20..285 304 28.4 Plus
Dgri\GH22640-PA 298 GH22640-PA 31..298 29..285 170 24.8 Plus
Dgri\GH12615-PA 294 GH12615-PA 34..213 42..206 145 25.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6984-PA 285 CG6984-PA 1..285 1..285 1467 100 Plus
Echs1-PA 295 CG6543-PA 48..295 38..285 297 28.9 Plus
Echs1-PB 295 CG6543-PB 48..295 38..285 297 28.9 Plus
CG8778-PA 299 CG8778-PA 32..297 29..283 185 26.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18602-PA 283 GI18602-PA 1..281 1..284 963 63.3 Plus
Dmoj\GI20973-PA 293 GI20973-PA 24..293 20..285 321 29.5 Plus
Dmoj\GI21154-PA 301 GI21154-PA 20..301 13..285 162 23.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17233-PA 225 GL17233-PA 1..225 61..285 962 78.7 Plus
Dper\GL16995-PA 296 GL16995-PA 74..296 63..285 251 27.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20005-PB 285 GA20005-PB 1..285 1..285 1126 74.2 Plus
Dpse\GA19673-PB 296 GA19673-PB 49..296 38..285 301 29.3 Plus
Dpse\GA19673-PA 296 GA19673-PA 49..296 38..285 301 29.3 Plus
Dpse\GA21314-PA 298 GA21314-PA 45..298 39..285 155 23.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21756-PA 285 GM21756-PA 1..285 1..285 1479 96.8 Plus
Dsec\GM20252-PA 294 GM20252-PA 24..294 20..285 303 28.3 Plus
Dsec\GM17776-PA 280 GM17776-PA 28..207 34..212 147 24.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11247-PA 226 GD11247-PA 1..226 60..285 1195 98.2 Plus
Dsim\GD25738-PA 294 GD25738-PA 24..294 20..285 303 28.3 Plus
Dsim\GD25824-PA 299 GD25824-PA 6..299 13..285 178 25.9 Plus
Dsim\GD13579-PA 262 GD13579-PA 9..196 34..217 152 24.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21618-PA 254 GJ21618-PA 3..252 36..284 880 67.2 Plus
Dvir\GJ20693-PA 293 GJ20693-PA 24..293 20..285 301 28.7 Plus
Dvir\GJ21004-PA 281 GJ21004-PA 28..281 39..285 158 23.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17869-PA 283 GK17869-PA 1..282 1..285 949 63.5 Plus
Dwil\GK17937-PA 295 GK17937-PA 48..295 38..285 304 29.3 Plus
Dwil\GK15915-PA 302 GK15915-PA 33..302 27..285 166 24.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11645-PA 285 GE11645-PA 1..284 1..284 1490 97.2 Plus
Dyak\GE13337-PA 294 GE13337-PA 24..294 20..285 304 28.3 Plus
Dyak\GE13432-PA 299 GE13432-PA 32..299 29..285 175 26.1 Plus