Clone GH22719 Report

Search the DGRC for GH22719

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:227
Well:19
Vector:pOT2
Associated Gene/TranscriptCG1942-RA
Protein status:GH22719.pep: gold
Preliminary Size:1380
Sequenced Size:1280

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1942 2001-01-01 Release 2 assignment
CG1942 2001-11-29 Blastp of sequenced clone
CG1942 2003-01-01 Sim4 clustering to Release 3
CG1942 2008-04-29 Release 5.5 accounting
CG1942 2008-08-15 Release 5.9 accounting
CG1942 2008-12-18 5.12 accounting

Clone Sequence Records

GH22719.complete Sequence

1280 bp (1280 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069178

> GH22719.complete
CCGAGAGCCGATAAGGATAAGTATAAGTCTAGTACAGGGCAATTTGACCA
TCGCTGGCTTCCATATCATTCAGTCGTGGGAGAACCGCCGAAAGAGCAGC
TGGTGGAGTTTTTTTGGGCATTTTTGTAACACAGCAGACATGAAAATCGA
GTGGGCACCACTGCGGGTTCCTCTGGAACGCCGACTGCAGATACTGGTCA
CGGCCTTTTTCACCTCCATGCTGCTGATACTATTGTCAGTTTCCTTCCTT
TTGGTAGCTGGATCACTGATCTACGGAGGTCTTTTGGTGCGTAGTCTGAT
GGTAACTTACTTGGCCTACGTCTTTGTGCACCACAAGAAAACCCAATCCG
TTGTGGATGGCAATGGCTGGATGATAACACGCACCAACCTTTTGCATCGC
CACTATCGTGATTACTTTCCCGTGGAGCTGGTGAAAACAGCCGAACTGCC
AGCTACTAAGAACTACATCTTGGCCAGCTTTCCCCACGGAATTCTGGGCA
CAGGCATTGGCATTAACATGGGCTTGGAAATCTCCAAGTGGCTGGAGCTA
TTCCCCCAAGTGCGTCCCAAACTGGGCACTCTGGATCAGCATTTCCATGT
TCCGTTCATGCGTGAGGTCCTCCGCTGCTGGGGTCTGGTGTCAGTGTCCA
AAGAGGCGCTGATCCGTATGCTCAGCAAGTCAAATGATCCCAAGCACAAG
GATAATCGGGATGGTTTCACCTCCAATGCGGTGGCCATTCTGGTTGGCGG
TGCCCAGGAAGCCATGGACTCTCATCCTGGGCAGTACATTTTAACCTTGA
AGAATAGGAAAGGCTTCGTGCGAATGGCCATTAGAACGGGCTCATCGATT
GTTCCTTCATTTTCCTTTGGAGAGGTGGACATTTTCGATCAGGTGGCAAA
TCCCCCCAACTCGCTGCTCCGACGGTTTCAGGACTTTGTCAAGAAGCTCA
CCGGAGTCTCTCCGCTGATTCCTGTGGGCCGCGGATTCTTCAACTACACC
TTTGGCTTCCTCCCATTCCGACGACGCATTGTCCAAGTTGTTGGTGCTCC
CATCGATGTTGTTAAGAACGAGCACCCAGACTCGGAGTATGTGGATAAAG
TGCATGGACAGGTCATTGAGTCGCTGGAGAAGTTATTCGATCAGTACAAA
GACAAGTACTTGGAGAATTCGAAGAGTGCCACTCTAGTTGTACACTAGTT
TTAAATCATGTTGATACAAAATATTCCTATGTATTGAAATAGAAACGAGC
TTTTTAATTGAAAAAAAAAAAAAAAAAAAA

GH22719.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG1942-RA 1441 CG1942-RA 133..1394 1..1262 6310 100 Plus
CG1941-RA 1444 CG1941-RA 658..1148 669..1159 895 78.8 Plus
CG1941.a 1528 CG1941.a 742..1232 669..1159 895 78.8 Plus
CG1941-RA 1444 CG1941-RA 386..577 397..588 375 79.6 Plus
CG1941.a 1528 CG1941.a 470..661 397..588 375 79.6 Plus
CG1941-RA 1444 CG1941-RA 300..360 311..371 155 83.6 Plus
CG1941.a 1528 CG1941.a 384..444 311..371 155 83.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3600622..3600964 498..840 1700 99.7 Plus
chr2R 21145070 chr2R 3599941..3600208 1..268 1340 100 Plus
chr2R 21145070 chr2R 3601280..3601500 1040..1260 1090 99.5 Plus
chr2R 21145070 chr2R 3601021..3601221 840..1040 990 99.5 Plus
chr2R 21145070 chr2R 3600424..3600556 366..498 665 100 Plus
chr2R 21145070 chr2R 3600268..3600366 268..366 495 100 Plus
chr2R 21145070 chr2R 3603208..3603517 510..819 485 77.1 Plus
chr2R 21145070 chr2R 3598397..3598728 503..834 430 75.3 Plus
chr2R 21145070 chr2R 3598799..3598994 845..1040 425 81.1 Plus
chr2R 21145070 chr2R 3603601..3603796 845..1040 320 77.6 Plus
chr2R 21145070 chr2R 3598197..3598298 397..498 225 81.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:03:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7713304..7713646 498..840 1715 100 Plus
2R 25286936 2R 7712623..7712890 1..268 1340 100 Plus
2R 25286936 2R 7713962..7714184 1040..1262 1115 100 Plus
2R 25286936 2R 7713703..7713903 840..1040 1005 100 Plus
2R 25286936 2R 7713106..7713238 366..498 665 100 Plus
2R 25286936 2R 7712950..7713048 268..366 495 100 Plus
2R 25286936 2R 7715890..7716199 510..819 485 77.1 Plus
2R 25286936 2R 7711079..7711410 503..834 430 75.3 Plus
2R 25286936 2R 7711481..7711676 845..1040 425 81.1 Plus
2R 25286936 2R 7716283..7716478 845..1040 320 77.6 Plus
2R 25286936 2R 7710879..7710980 397..498 225 81.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:20:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7714503..7714845 498..840 1715 100 Plus
2R 25260384 2R 7713822..7714089 1..268 1340 100 Plus
2R 25260384 2R 7715161..7715383 1040..1262 1115 100 Plus
2R 25260384 2R 7714902..7715102 840..1040 1005 100 Plus
2R 25260384 2R 7714305..7714437 366..498 665 100 Plus
2R 25260384 2R 7714149..7714247 268..366 495 100 Plus
2R 25260384 2R 7717250..7717398 671..819 445 86.5 Plus
2R 25260384 2R 7712680..7712875 845..1040 425 81.1 Plus
2R 25260384 2R 7712444..7712609 669..834 335 80.1 Plus
2R 25260384 2R 7717482..7717677 845..1040 320 77.5 Plus
2R 25260384 2R 7712078..7712179 397..498 225 81.3 Plus
2R 25260384 2R 7712278..7712363 503..588 160 79 Plus
2R 25260384 2R 7712941..7713060 1040..1159 150 75 Plus
Blast to na_te.dros performed 2019-03-15 17:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
jockey2 3428 jockey2 JOCKEY2 3428bp 2830..2879 833..784 115 70 Minus

GH22719.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:51:27 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3600269..3600366 269..366 100 -> Plus
chr2R 3600425..3600556 367..498 100 -> Plus
chr2R 3599941..3600208 1..268 100 -> Plus
chr2R 3600623..3600964 499..840 99 -> Plus
chr2R 3601022..3601221 841..1040 99 -> Plus
chr2R 3601281..3601500 1041..1260 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:52:42 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
CG1942-RA 1..1059 140..1198 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:25:24 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
CG1942-RA 1..1059 140..1198 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:48:20 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
CG1942-RA 1..1059 140..1198 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:52:34 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
CG1942-RA 1..1059 140..1198 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:31 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
CG1942-RA 1..1059 140..1198 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:01:17 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
CG1942-RA 1..1260 1..1260 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:25:24 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
CG1942-RA 1..1260 1..1260 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:48:20 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
CG1942-RA 46..1305 1..1260 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:52:34 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
CG1942-RA 1..1260 1..1260 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:31 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
CG1942-RA 46..1305 1..1260 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:51:27 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7712623..7712890 1..268 100 -> Plus
2R 7712951..7713048 269..366 100 -> Plus
2R 7713107..7713238 367..498 100 -> Plus
2R 7713305..7713646 499..840 100 -> Plus
2R 7713704..7713903 841..1040 100 -> Plus
2R 7713963..7714182 1041..1260 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:51:27 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7712623..7712890 1..268 100 -> Plus
2R 7712951..7713048 269..366 100 -> Plus
2R 7713107..7713238 367..498 100 -> Plus
2R 7713305..7713646 499..840 100 -> Plus
2R 7713704..7713903 841..1040 100 -> Plus
2R 7713963..7714182 1041..1260 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:51:27 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7712623..7712890 1..268 100 -> Plus
2R 7712951..7713048 269..366 100 -> Plus
2R 7713107..7713238 367..498 100 -> Plus
2R 7713305..7713646 499..840 100 -> Plus
2R 7713704..7713903 841..1040 100 -> Plus
2R 7713963..7714182 1041..1260 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:48:20 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3600456..3600553 269..366 100 -> Plus
arm_2R 3600612..3600743 367..498 100 -> Plus
arm_2R 3601209..3601408 841..1040 100 -> Plus
arm_2R 3601468..3601687 1041..1260 100   Plus
arm_2R 3600810..3601151 499..840 100 -> Plus
arm_2R 3600128..3600395 1..268 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:28:43 Download gff for GH22719.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7713822..7714089 1..268 100 -> Plus
2R 7714150..7714247 269..366 100 -> Plus
2R 7714306..7714437 367..498 100 -> Plus
2R 7714504..7714845 499..840 100 -> Plus
2R 7714903..7715102 841..1040 100 -> Plus
2R 7715162..7715381 1041..1260 100   Plus

GH22719.hyp Sequence

Translation from 0 to 1197

> GH22719.hyp
REPIRISISLVQGNLTIAGFHIIQSWENRRKSSWWSFFGHFCNTADMKIE
WAPLRVPLERRLQILVTAFFTSMLLILLSVSFLLVAGSLIYGGLLVRSLM
VTYLAYVFVHHKKTQSVVDGNGWMITRTNLLHRHYRDYFPVELVKTAELP
ATKNYILASFPHGILGTGIGINMGLEISKWLELFPQVRPKLGTLDQHFHV
PFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTSNAVAILVGG
AQEAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVAN
PPNSLLRRFQDFVKKLTGVSPLIPVGRGFFNYTFGFLPFRRRIVQVVGAP
IDVVKNEHPDSEYVDKVHGQVIESLEKLFDQYKDKYLENSKSATLVVH*

GH22719.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG1942-PA 352 CG1942-PA 1..352 47..398 1819 100 Plus
CG1941-PD 352 CG1941-PD 1..352 47..398 1376 73 Plus
CG1941-PC 352 CG1941-PC 1..352 47..398 1376 73 Plus
CG1941-PB 352 CG1941-PB 1..352 47..398 1376 73 Plus
CG1941-PA 352 CG1941-PA 1..352 47..398 1376 73 Plus

GH22719.pep Sequence

Translation from 139 to 1197

> GH22719.pep
MKIEWAPLRVPLERRLQILVTAFFTSMLLILLSVSFLLVAGSLIYGGLLV
RSLMVTYLAYVFVHHKKTQSVVDGNGWMITRTNLLHRHYRDYFPVELVKT
AELPATKNYILASFPHGILGTGIGINMGLEISKWLELFPQVRPKLGTLDQ
HFHVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTSNAVAI
LVGGAQEAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFD
QVANPPNSLLRRFQDFVKKLTGVSPLIPVGRGFFNYTFGFLPFRRRIVQV
VGAPIDVVKNEHPDSEYVDKVHGQVIESLEKLFDQYKDKYLENSKSATLV
VH*

GH22719.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13198-PA 352 GF13198-PA 1..352 1..352 1622 86.6 Plus
Dana\GF13197-PA 352 GF13197-PA 1..352 1..352 1403 72.7 Plus
Dana\GF13199-PA 351 GF13199-PA 1..351 1..352 1251 65.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23299-PA 352 GG23299-PA 1..352 1..352 1794 95.2 Plus
Dere\GG23298-PA 352 GG23298-PA 1..352 1..352 1398 72.2 Plus
Dere\GG23300-PA 349 GG23300-PA 1..349 1..352 1281 67.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20316-PA 352 GH20316-PA 1..352 1..352 1348 70.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgat2-PA 352 CG1942-PA 1..352 1..352 1819 100 Plus
CG1941-PD 352 CG1941-PD 1..352 1..352 1376 73 Plus
CG1941-PC 352 CG1941-PC 1..352 1..352 1376 73 Plus
CG1941-PB 352 CG1941-PB 1..352 1..352 1376 73 Plus
CG1941-PA 352 CG1941-PA 1..352 1..352 1376 73 Plus
CG1946-PA 349 CG1946-PA 1..348 1..351 1255 67.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19988-PA 352 GI19988-PA 1..352 1..352 1141 59.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10526-PA 352 GL10526-PA 1..352 1..352 1539 79.5 Plus
Dper\GL10527-PA 352 GL10527-PA 1..352 1..352 1409 72.7 Plus
Dper\GL10836-PA 352 GL10836-PA 1..352 1..352 1398 71.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15143-PA 352 GA15143-PA 1..352 1..352 1539 79.5 Plus
Dpse\GA24395-PA 352 GA24395-PA 1..352 1..352 1413 72.7 Plus
Dpse\GA15142-PA 352 GA15142-PA 1..352 1..352 1397 71.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20977-PA 352 GM20977-PA 1..352 1..352 1819 97.2 Plus
Dsec\GM20976-PA 352 GM20976-PA 1..352 1..352 1412 72.4 Plus
Dsec\GM20978-PA 349 GM20978-PA 1..349 1..352 1277 67.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10505-PA 352 GD10505-PA 1..352 1..352 1842 98.6 Plus
Dsim\GD10504-PA 352 GD10504-PA 1..352 1..352 1405 72.2 Plus
Dsim\GD15355-PA 349 GD15355-PA 1..349 1..352 1280 68.2 Plus
Dsim\GD15354-PA 253 GD15354-PA 1..251 1..261 1274 93.5 Plus
Dsim\GD10506-PA 349 GD10506-PA 1..349 1..352 1270 67.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21238-PA 352 GJ21238-PA 1..352 1..352 1399 71.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21715-PA 352 GK21715-PA 1..352 1..352 1427 73 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19145-PA 352 GE19145-PA 1..352 1..352 1815 97.2 Plus
Dyak\GE19144-PA 352 GE19144-PA 1..352 1..352 1407 72.4 Plus
Dyak\GE19146-PA 349 GE19146-PA 1..349 1..352 1270 68.2 Plus