Clone GH22765 Report

Search the DGRC for GH22765

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:227
Well:65
Vector:pOT2
Associated Gene/TranscriptCG8960-RA
Protein status:GH22765.pep: gold
Preliminary Size:1131
Sequenced Size:1034

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8960 2001-01-01 Release 2 assignment
CG8960 2001-10-10 Blastp of sequenced clone
CG8960 2003-01-01 Sim4 clustering to Release 3
CG8960 2008-04-29 Release 5.5 accounting
CG8960 2008-08-15 Release 5.9 accounting
CG8960 2008-12-18 5.12 accounting

Clone Sequence Records

GH22765.complete Sequence

1034 bp (1034 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060762

> GH22765.complete
TCATACAAATGTGGACTTCATTTTAGCTTGAAATTTCTCGCTGTGCCGCA
CAGGACCTTTGTTAGCATCTTGCTCAGACTTGCCGTTCCGTGGAAGGAAA
CTTAATGCTGTATTTACGGCCACAGATGCAGATACTTCTGCTGATGGTCC
GTTCGTTGCCTGTCGTTGAGGTCGATACCGAATGGATATATTTTCCGCAA
AATCATAAACACATTTGGTCGCTGCCGTTCTGGCTGATTACCTAATCTGA
AGGACTAAATGCTAAATGTACCATTACCTGGTAGTTTCCTAAGGTACAGT
TCTATCCCGTGAAAAACCAGCGGTACCTACTGGTCTACCTAGCCATCCAA
CAGAAGGTACTTAGGTAGAGGAAGGTTATCTGGCGATAGTCAGCCCCGAA
TCGTCGTCCGTTGAGAGCGTGAGTTTTTGAGTCTGTGATAGTTAGACCCA
GTGCCAAGTGCCCAGGATGTTATTCCTAGCGCCGCGCAAACATCTGTTTG
CCACCAACCTGATCATCCTGCTGATGATCTACTTGATGCGCAAGTGCCTG
CAGCTCTTCTGCATCATCGAGAACCGCGCCGTTCATCCGGCCGAGGAAGA
GGAGAAGGAGGTCAAGTTGCCGGAAAGGGAGATCCTCCAGAAGCGCCGCG
GCGGCTTCACCATCATCCCAGCTGCCATGCACCAGAGCATGCACGGCTTC
GGCTACGGCGAGGGTCACTACCAGATCTTTGTGGAGAAGAAGGAGCGTAA
CCTCCCAACCAAATCGCGCCTTAACGCGGCCACTGCTGAAGTCAAGCTGA
ATCCCAATTAGTTAGTTGCCCGCGACCAAAGGGAACCACTGACATCCCAG
CATGTCAATGACAATGTGCCAATTGAGCCCAGCAAAGCAAAATCAAACCC
AATCCACAAATATCCCTCTACATCCAAGTCTTCTTCAATAGTCTAAATAA
TATCTAATGCATGGAACAACAAACACTTATTTTGTACAGTCATCAAAGCG
CATTATTGGCCATAATAAAAAAAAAAAAAAAAAA

GH22765.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-RA 1060 CG8960-RA 27..1058 1..1032 5130 99.8 Plus
CG8960-RB 609 CG8960-RB 59..609 480..1030 2725 99.6 Plus
CG8960-RB 609 CG8960-RB 23..58 383..418 180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2196875..2197508 383..1016 3125 99.5 Plus
chr3L 24539361 chr3L 2196432..2196821 1..390 1860 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:03:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2197456..2198105 383..1032 3220 99.7 Plus
3L 28110227 3L 2197013..2197402 1..390 1920 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2197456..2198105 383..1032 3220 99.6 Plus
3L 28103327 3L 2197013..2197402 1..390 1920 99.4 Plus
Blast to na_te.dros performed on 2019-03-16 08:23:25 has no hits.

GH22765.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:24:05 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2196432..2196814 1..383 98 -> Plus
chr3L 2196876..2197508 384..1016 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:52:47 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 1..345 467..811 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:51:25 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 1..345 467..811 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:16:13 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 1..345 467..811 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:20:31 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 1..345 467..811 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:40:06 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 1..345 467..811 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:36:16 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 1..1016 1..1016 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:51:25 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 1..1016 1..1016 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:16:13 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 1..1016 1..1016 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:20:31 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 1..1016 1..1016 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:40:06 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 1..1016 1..1016 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:24:05 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2197013..2197395 1..383 100 -> Plus
3L 2197457..2198089 384..1016 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:24:05 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2197013..2197395 1..383 100 -> Plus
3L 2197457..2198089 384..1016 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:24:05 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2197013..2197395 1..383 100 -> Plus
3L 2197457..2198089 384..1016 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:16:13 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2197013..2197395 1..383 100 -> Plus
arm_3L 2197457..2198089 384..1016 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:57:13 Download gff for GH22765.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2197013..2197395 1..383 100 -> Plus
3L 2197457..2198089 384..1016 100   Plus

GH22765.hyp Sequence

Translation from 466 to 810

> GH22765.hyp
MLFLAPRKHLFATNLIILLMIYLMRKCLQLFCIIENRAVHPAEEEEKEVK
LPEREILQKRRGGFTIIPAAMHQSMHGFGYGEGHYQIFVEKKERNLPTKS
RLNAATAEVKLNPN*

GH22765.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-PA 114 CG8960-PA 1..114 1..114 591 100 Plus
CG8960-PB 95 CG8960-PB 1..95 20..114 498 100 Plus

GH22765.pep Sequence

Translation from 466 to 810

> GH22765.pep
MLFLAPRKHLFATNLIILLMIYLMRKCLQLFCIIENRAVHPAEEEEKEVK
LPEREILQKRRGGFTIIPAAMHQSMHGFGYGEGHYQIFVEKKERNLPTKS
RLNAATAEVKLNPN*

GH22765.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24854-PA 113 GF24854-PA 1..113 1..114 471 79.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14843-PA 113 GG14843-PA 1..113 1..114 566 95.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14997-PA 116 GH14997-PA 1..116 1..114 426 70.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-PA 114 CG8960-PA 1..114 1..114 591 100 Plus
CG8960-PB 95 CG8960-PB 1..95 20..114 498 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13159-PA 115 GI13159-PA 1..115 1..114 424 70.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21436-PA 121 GA21436-PA 1..121 1..114 439 73.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14468-PA 114 GM14468-PA 1..114 1..114 585 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13665-PA 114 GD13665-PA 1..114 1..114 593 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11934-PA 115 GJ11934-PA 1..115 1..114 430 71.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12533-PA 118 GK12533-PA 1..118 1..114 457 74.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21207-PA 109 GE21207-PA 1..109 1..114 535 90.4 Plus