Clone GH22911 Report

Search the DGRC for GH22911

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:229
Well:11
Vector:pOT2
Associated Gene/TranscriptVago-RB
Protein status:GH22911.pep: gold
Preliminary Size:806
Sequenced Size:692

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lost to the ancients 2010-01-15 I'm sure there was a reason

Clone Sequence Records

GH22911.complete Sequence

692 bp assembled on 2010-01-15

GenBank Submission: BT120136.1

> GH22911.complete
CTAAACTTTGCAAACGTCGGGCCAAATTCTGTCCGCCGATCTCAGTTCTT
TCGAATAGCAAATTTTCACAAATGGAGTCAATTAGCAGCATGATTTATTT
AGTGGCCATGATGTCATTGATCATCGGTGGCAGCCAAGCGATTCCTTATC
GACCCTCGGCGTATCTGTACAATCAGCAGTACTGTATGGATACATTGACG
GGTCGGCAGCTTTATATCGGTGAAGTCTTCACGCGAGAGGATCAGTGCGT
CCGCATCCAATGCCTGGAAACGCTGCAACTCTGGGAGGATAGCTGCCAGG
TGCCGAAACTGACGCAGGGCAATTGCACGCCAGTTCCATCGACGAACCCG
CATGCCGAATATCCCCGATGCTGCCCACTGTATGAGTGCAAGAGCTACGA
GTCGAATTCGGGGGGAACTCTGGAGCAGACCAACATATATGACCACTATG
GTACTCTGCGATCATCCCATCTCACTGAGATGATAGTGATCGACGGGCGG
ACACCCCCTCGTGGCGAGATTCACACGGCGTCGGCGAGGAAGTATCAGGT
GTGAGAAGTGAACTGGTACTCTGTTCCTAGGACTACTTAGTCTTTAGTGC
AGATCTAATGTGTACAAATACAAATGGAGTTTATTGCGGAATACTTGAAT
ATGTTAAATAAATTTAAATTTCACAAAAAAAAAAAAAAAAAA

GH22911.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-RB 845 Vago-RB 95..769 1..675 3375 100 Plus
Vago-RC 748 Vago-RC 367..748 291..672 1910 100 Plus
Vago-RC 748 Vago-RC 11..302 1..292 1460 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10980975..10981358 291..674 1890 99.5 Plus
chrX 22417052 chrX 10980551..10980703 1..153 750 99.3 Plus
chrX 22417052 chrX 10980772..10980910 154..292 695 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:03:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11089724..11090108 291..675 1925 100 Plus
X 23542271 X 11089300..11089452 1..153 765 100 Plus
X 23542271 X 11089521..11089659 154..292 695 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11097822..11098206 291..675 1925 100 Plus
X 23527363 X 11097398..11097550 1..153 765 100 Plus
X 23527363 X 11097619..11097757 154..292 695 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:07:07 has no hits.

GH22911.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:08:06 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10980551..10980703 1..153 99 -> Plus
chrX 10980772..10980910 154..292 100 -> Plus
chrX 10980977..10981358 293..674 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-15 14:20:24 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 1..483 72..554 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:48 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 1..483 72..554 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:28:10 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 1..483 72..554 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:19:42 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 1..483 72..554 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-15 14:20:23 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 11..682 1..672 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:48 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 11..682 1..672 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:28:10 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 11..684 1..674 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:19:42 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 11..684 1..674 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:08:06 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
X 11089300..11089452 1..153 100 -> Plus
X 11089521..11089659 154..292 100 -> Plus
X 11089726..11090107 293..674 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:08:06 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
X 11089300..11089452 1..153 100 -> Plus
X 11089521..11089659 154..292 100 -> Plus
X 11089726..11090107 293..674 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:08:06 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
X 11089300..11089452 1..153 100 -> Plus
X 11089521..11089659 154..292 100 -> Plus
X 11089726..11090107 293..674 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:28:10 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10983333..10983485 1..153 100 -> Plus
arm_X 10983554..10983692 154..292 100 -> Plus
arm_X 10983759..10984140 293..674 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:29:01 Download gff for GH22911.complete
Subject Subject Range Query Range Percent Splice Strand
X 11097824..11098205 293..674 100   Plus
X 11097398..11097550 1..153 100 -> Plus
X 11097619..11097757 154..292 100 -> Plus

GH22911.hyp Sequence

Translation from 2 to 553

> GH22911.hyp
KLCKRRAKFCPPISVLSNSKFSQMESISSMIYLVAMMSLIIGGSQAIPYR
PSAYLYNQQYCMDTLTGRQLYIGEVFTREDQCVRIQCLETLQLWEDSCQV
PKLTQGNCTPVPSTNPHAEYPRCCPLYECKSYESNSGGTLEQTNIYDHYG
TLRSSHLTEMIVIDGRTPPRGEIHTASARKYQV*

GH22911.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-PD 160 CG2081-PD 1..160 24..183 864 100 Plus
Vago-PB 160 CG2081-PB 1..160 24..183 864 100 Plus

GH22911.pep Sequence

Translation from 2 to 553

> GH22911.pep
KLCKRRAKFCPPISVLSNSKFSQMESISSMIYLVAMMSLIIGGSQAIPYR
PSAYLYNQQYCMDTLTGRQLYIGEVFTREDQCVRIQCLETLQLWEDSCQV
PKLTQGNCTPVPSTNPHAEYPRCCPLYECKSYESNSGGTLEQTNIYDHYG
TLRSSHLTEMIVIDGRTPPRGEIHTASARKYQV*

GH22911.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20289-PA 165 GF20289-PA 1..165 24..183 504 58.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18386-PA 158 GG18386-PA 1..158 24..183 691 81.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17919-PA 164 GH17919-PA 1..164 24..183 438 50.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-PD 160 CG2081-PD 1..160 24..183 864 100 Plus
Vago-PB 160 CG2081-PB 1..160 24..183 864 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16062-PA 141 GI16062-PA 1..141 47..183 416 56.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18255-PA 162 GL18255-PA 5..161 26..181 500 58.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15228-PA 162 GA15228-PA 5..161 26..181 499 58.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11452-PA 160 GM11452-PA 1..160 24..183 771 90.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17004-PA 160 GD17004-PA 1..160 24..183 774 91.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15634-PA 148 GJ15634-PA 23..148 59..183 432 63.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19983-PA 213 GK19983-PA 126..213 97..183 256 55.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15903-PA 158 GE15903-PA 1..158 24..183 697 83.1 Plus