BDGP Sequence Production Resources |
Search the DGRC for GH22911
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 229 |
Well: | 11 |
Vector: | pOT2 |
Associated Gene/Transcript | Vago-RB |
Protein status: | GH22911.pep: gold |
Preliminary Size: | 806 |
Sequenced Size: | 692 |
Gene | Date | Evidence |
---|---|---|
Lost to the ancients | 2010-01-15 | I'm sure there was a reason |
692 bp assembled on 2010-01-15
GenBank Submission: BT120136.1
> GH22911.complete CTAAACTTTGCAAACGTCGGGCCAAATTCTGTCCGCCGATCTCAGTTCTT TCGAATAGCAAATTTTCACAAATGGAGTCAATTAGCAGCATGATTTATTT AGTGGCCATGATGTCATTGATCATCGGTGGCAGCCAAGCGATTCCTTATC GACCCTCGGCGTATCTGTACAATCAGCAGTACTGTATGGATACATTGACG GGTCGGCAGCTTTATATCGGTGAAGTCTTCACGCGAGAGGATCAGTGCGT CCGCATCCAATGCCTGGAAACGCTGCAACTCTGGGAGGATAGCTGCCAGG TGCCGAAACTGACGCAGGGCAATTGCACGCCAGTTCCATCGACGAACCCG CATGCCGAATATCCCCGATGCTGCCCACTGTATGAGTGCAAGAGCTACGA GTCGAATTCGGGGGGAACTCTGGAGCAGACCAACATATATGACCACTATG GTACTCTGCGATCATCCCATCTCACTGAGATGATAGTGATCGACGGGCGG ACACCCCCTCGTGGCGAGATTCACACGGCGTCGGCGAGGAAGTATCAGGT GTGAGAAGTGAACTGGTACTCTGTTCCTAGGACTACTTAGTCTTTAGTGC AGATCTAATGTGTACAAATACAAATGGAGTTTATTGCGGAATACTTGAAT ATGTTAAATAAATTTAAATTTCACAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 10980975..10981358 | 291..674 | 1890 | 99.5 | Plus |
chrX | 22417052 | chrX | 10980551..10980703 | 1..153 | 750 | 99.3 | Plus |
chrX | 22417052 | chrX | 10980772..10980910 | 154..292 | 695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 10980551..10980703 | 1..153 | 99 | -> | Plus |
chrX | 10980772..10980910 | 154..292 | 100 | -> | Plus |
chrX | 10980977..10981358 | 293..674 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vago-RB | 1..483 | 72..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vago-RB | 1..483 | 72..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vago-RB | 1..483 | 72..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vago-RB | 1..483 | 72..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vago-RB | 11..682 | 1..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vago-RB | 11..682 | 1..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vago-RB | 11..684 | 1..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vago-RB | 11..684 | 1..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11089300..11089452 | 1..153 | 100 | -> | Plus |
X | 11089521..11089659 | 154..292 | 100 | -> | Plus |
X | 11089726..11090107 | 293..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11089300..11089452 | 1..153 | 100 | -> | Plus |
X | 11089521..11089659 | 154..292 | 100 | -> | Plus |
X | 11089726..11090107 | 293..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11089300..11089452 | 1..153 | 100 | -> | Plus |
X | 11089521..11089659 | 154..292 | 100 | -> | Plus |
X | 11089726..11090107 | 293..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 10983333..10983485 | 1..153 | 100 | -> | Plus |
arm_X | 10983554..10983692 | 154..292 | 100 | -> | Plus |
arm_X | 10983759..10984140 | 293..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11097824..11098205 | 293..674 | 100 | Plus | |
X | 11097398..11097550 | 1..153 | 100 | -> | Plus |
X | 11097619..11097757 | 154..292 | 100 | -> | Plus |
Translation from 2 to 553
> GH22911.hyp KLCKRRAKFCPPISVLSNSKFSQMESISSMIYLVAMMSLIIGGSQAIPYR PSAYLYNQQYCMDTLTGRQLYIGEVFTREDQCVRIQCLETLQLWEDSCQV PKLTQGNCTPVPSTNPHAEYPRCCPLYECKSYESNSGGTLEQTNIYDHYG TLRSSHLTEMIVIDGRTPPRGEIHTASARKYQV*
Translation from 2 to 553
> GH22911.pep KLCKRRAKFCPPISVLSNSKFSQMESISSMIYLVAMMSLIIGGSQAIPYR PSAYLYNQQYCMDTLTGRQLYIGEVFTREDQCVRIQCLETLQLWEDSCQV PKLTQGNCTPVPSTNPHAEYPRCCPLYECKSYESNSGGTLEQTNIYDHYG TLRSSHLTEMIVIDGRTPPRGEIHTASARKYQV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20289-PA | 165 | GF20289-PA | 1..165 | 24..183 | 504 | 58.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18386-PA | 158 | GG18386-PA | 1..158 | 24..183 | 691 | 81.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17919-PA | 164 | GH17919-PA | 1..164 | 24..183 | 438 | 50.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Vago-PD | 160 | CG2081-PD | 1..160 | 24..183 | 864 | 100 | Plus |
Vago-PB | 160 | CG2081-PB | 1..160 | 24..183 | 864 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16062-PA | 141 | GI16062-PA | 1..141 | 47..183 | 416 | 56.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18255-PA | 162 | GL18255-PA | 5..161 | 26..181 | 500 | 58.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15228-PA | 162 | GA15228-PA | 5..161 | 26..181 | 499 | 58.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11452-PA | 160 | GM11452-PA | 1..160 | 24..183 | 771 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17004-PA | 160 | GD17004-PA | 1..160 | 24..183 | 774 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15634-PA | 148 | GJ15634-PA | 23..148 | 59..183 | 432 | 63.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19983-PA | 213 | GK19983-PA | 126..213 | 97..183 | 256 | 55.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15903-PA | 158 | GE15903-PA | 1..158 | 24..183 | 697 | 83.1 | Plus |