Clone GH22994 Report

Search the DGRC for GH22994

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:229
Well:94
Vector:pOT2
Associated Gene/TranscriptCG10126-RA
Protein status:GH22994.pep: gold
Preliminary Size:995
Sequenced Size:901

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10126 2001-01-01 Release 2 assignment
CG10126 2001-10-10 Blastp of sequenced clone
CG10126 2003-01-01 Sim4 clustering to Release 3
CG10126 2008-04-29 Release 5.5 accounting
CG10126 2008-08-15 Release 5.9 accounting
CG10126 2008-12-18 5.12 accounting

Clone Sequence Records

GH22994.complete Sequence

901 bp (901 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060767

> GH22994.complete
TAACAAGTATCTTGCAGTTATCCATTCAGTTGGGCGCCTATAAAAAAAAC
AAGCCCCCATCAAATTTTGTATAAAACTAGTGAAAAGGTCTATTCACGAA
TAAAAAACATGGAGAACCCGAACTGTGACCTCTACACCCTGGAGGCCAAC
ATGGCGAGTCAAGCGCTCCGGGAACTGACAGATGGCGAGGACAAGGATCC
CATTACCAAGCTGCGATTGCTGTGCCTCAGCCGCGGAGCAACAGGCATAC
TGGGATTGGGCAGGGCCTTCCGGGCGATGGACGACGATGGTAGCAAGGCT
CTGAATGAGGAGGAGTTCATCACTGGCATTAGGGACACCGGATTGGATGT
GTCGGAGGAGGAGATCAAGCAGATGTTCGCCACGTTTGATGAGGATGGCA
GTGGATCGATTAATATGACCGAGTTCCTGCTTAAACTAAGGCCCCCCATG
CCGCAGAGTCGTTTGAATATTATTGATCAGGCGTTCAACAAAATGGATCG
TGATGAAGATGGAGTAATTACCATTCAAGATCTTAAGAACGTGTACTCTG
TAAAAGAACATCCCAAGTACCAGTCTGGAGAAAAGTCTGAGGATGAAATT
CTTACCGACTTTTTGCACAACTTTGAGGGAGGTCGAGGAAACCTGGATGG
AAAGATAACCCGCGAGGAGTTTGTCAACTATTATGCCACCATTAGTGCCT
CAATTGACAACGATATGTTTTTTGATCTGATGATGCGACGTGCCTACGTC
ATGTAACTAGTGCGCAAATCTCACTGAACATTTTAATCTCAATCACTTTA
CTTGCCTCGAATTTAGTCCTGCTCATGTCCTATTTATACACTATATACAG
AAAATAAATAAAACGTCTGGTTGCAATTAAAAAAAAAAAAAAAAAAAAAA
A

GH22994.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG10126.c 1146 CG10126.c 245..1129 1..885 4410 99.8 Plus
CG10126-RA 1022 CG10126-RA 79..963 1..885 4410 99.8 Plus
CG10126.a 822 CG10126.a 65..810 140..885 3715 99.8 Plus
CG10126.a 822 CG10126.a 1..69 46..114 345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8680855..8681080 878..653 1130 100 Minus
chr3R 27901430 chr3R 8681136..8681349 654..441 1070 100 Minus
chr3R 27901430 chr3R 8681767..8681918 264..113 745 99.3 Minus
chr3R 27901430 chr3R 8681552..8681678 385..259 635 100 Minus
chr3R 27901430 chr3R 8682789..8682904 114..1 500 97.4 Minus
chr3R 27901430 chr3R 8681441..8681498 441..384 275 98.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:03:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12855537..12855769 885..653 1150 99.6 Minus
3R 32079331 3R 12855825..12856038 654..441 1070 100 Minus
3R 32079331 3R 12856456..12856607 264..113 760 100 Minus
3R 32079331 3R 12856241..12856367 385..259 635 100 Minus
3R 32079331 3R 12857490..12857603 114..1 570 100 Minus
3R 32079331 3R 12856130..12856187 441..384 290 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12596368..12596600 885..653 1150 99.5 Minus
3R 31820162 3R 12596656..12596869 654..441 1070 100 Minus
3R 31820162 3R 12597287..12597438 264..113 760 100 Minus
3R 31820162 3R 12597072..12597198 385..259 635 100 Minus
3R 31820162 3R 12598321..12598434 114..1 570 100 Minus
3R 31820162 3R 12596961..12597018 441..384 290 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:48:11 has no hits.

GH22994.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:48:53 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8681768..8681916 115..263 99 <- Minus
chr3R 8682789..8682904 1..114 97   Minus
chr3R 8681441..8681498 384..441 98 <- Minus
chr3R 8681554..8681673 264..383 100 <- Minus
chr3R 8680855..8681078 655..878 100 <- Minus
chr3R 8681136..8681348 442..654 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:53:12 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
CG10126-RA 1..648 109..756 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:31:39 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
CG10126-RA 1..648 109..756 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:41:26 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
CG10126-RA 1..648 109..756 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:59:32 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
CG10126-RA 1..648 109..756 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:16:44 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
CG10126-RA 1..648 109..756 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:10:22 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
CG10126-RA 1..878 1..878 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:31:39 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
CG10126-RA 1..878 1..878 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:41:26 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
CG10126-RA 30..907 1..878 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:59:32 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
CG10126-RA 1..878 1..878 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:16:44 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
CG10126-RA 30..907 1..878 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:53 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12855544..12855767 655..878 100 <- Minus
3R 12855825..12856037 442..654 100 <- Minus
3R 12856130..12856187 384..441 100 <- Minus
3R 12856243..12856362 264..383 100 <- Minus
3R 12856457..12856605 115..263 100 <- Minus
3R 12857490..12857603 1..114 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:53 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12855544..12855767 655..878 100 <- Minus
3R 12855825..12856037 442..654 100 <- Minus
3R 12856130..12856187 384..441 100 <- Minus
3R 12856243..12856362 264..383 100 <- Minus
3R 12856457..12856605 115..263 100 <- Minus
3R 12857490..12857603 1..114 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:53 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12855544..12855767 655..878 100 <- Minus
3R 12855825..12856037 442..654 100 <- Minus
3R 12856130..12856187 384..441 100 <- Minus
3R 12856243..12856362 264..383 100 <- Minus
3R 12856457..12856605 115..263 100 <- Minus
3R 12857490..12857603 1..114 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:41:26 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8681547..8681759 442..654 100 <- Minus
arm_3R 8681852..8681909 384..441 100 <- Minus
arm_3R 8681965..8682084 264..383 100 <- Minus
arm_3R 8682179..8682327 115..263 100 <- Minus
arm_3R 8683212..8683325 1..114 100   Minus
arm_3R 8681266..8681489 655..878 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:35:48 Download gff for GH22994.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12598321..12598434 1..114 100   Minus
3R 12596375..12596598 655..878 100 <- Minus
3R 12596656..12596868 442..654 100 <- Minus
3R 12596961..12597018 384..441 100 <- Minus
3R 12597074..12597193 264..383 100 <- Minus
3R 12597288..12597436 115..263 100 <- Minus

GH22994.pep Sequence

Translation from 108 to 755

> GH22994.pep
MENPNCDLYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGL
GRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGS
INMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKE
HPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASID
NDMFFDLMMRRAYVM*

GH22994.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:13:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18095-PA 227 GF18095-PA 13..227 1..215 1039 90.7 Plus
Dana\GF18097-PA 213 GF18097-PA 7..211 9..213 732 67.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:13:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17094-PA 227 GG17094-PA 13..227 1..215 1078 94.9 Plus
Dere\GG17096-PA 291 GG17096-PA 85..289 9..213 727 66.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:13:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19205-PA 215 GH19205-PA 1..215 1..215 954 84.7 Plus
Dgri\GH19207-PA 213 GH19207-PA 5..213 7..215 705 64.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG10126-PA 215 CG10126-PA 1..215 1..215 1109 100 Plus
CG10126-PB 227 CG10126-PB 13..227 1..215 1102 99.1 Plus
CG31345-PA 213 CG31345-PA 7..211 9..213 713 66.3 Plus
azot-PA 148 CG11165-PA 16..143 54..190 147 30.5 Plus
Cam-PD 149 CG8472-PD 16..143 53..189 141 30 Plus
Cam-PC 149 CG8472-PC 16..143 53..189 141 30 Plus
Cam-PE 149 CG8472-PE 16..143 53..189 141 30 Plus
Cam-PB 149 CG8472-PB 16..143 53..189 141 30 Plus
Cam-PA 149 CG8472-PA 16..143 53..189 141 30 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24237-PA 215 GI24237-PA 1..215 1..215 994 86.5 Plus
Dmoj\GI24240-PA 216 GI24240-PA 8..216 7..215 685 61.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23159-PA 232 GL23159-PA 21..232 4..215 997 86.3 Plus
Dper\GL23161-PA 245 GL23161-PA 39..243 9..213 716 67.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27168-PB 215 GA27168-PB 1..215 1..215 999 86 Plus
Dpse\GA27168-PA 232 GA27168-PA 21..232 4..215 992 86.3 Plus
Dpse\GA16196-PB 213 GA16196-PB 7..211 9..213 715 67.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25975-PA 227 GM25975-PA 13..227 1..215 1067 94.4 Plus
Dsec\GM25978-PA 358 GM25978-PA 152..356 9..213 730 66.3 Plus
Dsec\GM20994-PA 148 GM20994-PA 15..143 53..190 138 31.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20537-PA 227 GD20537-PA 13..227 1..215 1050 93.5 Plus
Dsim\GD20539-PA 275 GD20539-PA 69..273 9..213 726 66.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10812-PA 215 GJ10812-PA 1..215 1..215 990 86 Plus
Dvir\GJ10815-PA 244 GJ10815-PA 36..244 7..215 649 57.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10861-PA 200 GK10861-PA 2..200 17..215 925 86.9 Plus
Dwil\GK10864-PA 213 GK10864-PA 5..213 7..215 760 68.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24482-PA 227 GE24482-PA 13..227 1..215 1094 95.8 Plus
Dyak\GE24485-PA 213 GE24485-PA 7..211 9..213 730 66.8 Plus

GH22994.hyp Sequence

Translation from 108 to 755

> GH22994.hyp
MENPNCDLYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGL
GRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGS
INMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKE
HPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASID
NDMFFDLMMRRAYVM*

GH22994.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG10126-PA 215 CG10126-PA 1..215 1..215 1109 100 Plus
CG10126-PB 227 CG10126-PB 13..227 1..215 1102 99.1 Plus
CG31345-PA 213 CG31345-PA 7..211 9..213 713 66.3 Plus
CG11165-PA 148 CG11165-PA 16..143 54..190 147 30.5 Plus
Cam-PD 149 CG8472-PD 16..143 53..189 141 30 Plus