Clone GH23035 Report

Search the DGRC for GH23035

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:230
Well:35
Vector:pOT2
Associated Gene/Transcriptcrim-RA
Protein status:GH23035.pep: gold
Preliminary Size:886
Sequenced Size:757

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6038 2001-01-01 Release 2 assignment
CG6038 2001-10-10 Blastp of sequenced clone
CG6038 2003-01-01 Sim4 clustering to Release 3
CG6038 2008-04-29 Release 5.5 accounting
CG6038 2008-08-15 Release 5.9 accounting
CG6038 2008-12-18 5.12 accounting

Clone Sequence Records

GH23035.complete Sequence

757 bp (757 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060768

> GH23035.complete
CACTGCTCTCTAGGGCGTATCTTTTATTATTTACGTTGTGTATTTGTGTT
ATCTGTTTTATTTTGAAAAGAAACCCCGCTTTATTAAACAAAACATGCAC
TACCATACGAATCTCATTGCAGCCCTGCTGCTGGCAGCTCTAATTCACGA
GGGCTCTGCAATTTGGTGCTACCGCTGCACTTCGGCCACGCCCGGCTGTG
CGGAGAAGTTTAACTGGCGGGGAATAGGATTCCTGGGCGAGCACTGCCCG
GAACCGGACGACATTTGCGTCAAGGTGACGGAGCGACGCGGCGCCAGGGA
AACAATCACACGTGACTGCCTAAGCGCGCTGAGCTTCCGCAAAGACATTC
CCGCCGACAAATACGAAGGATGTCGTCCTGCCGCCCACGATGAAAAGCTA
GCGAACTACGTAAACCACACGATCAAGGAGCACGACGTGCGCCGTGACTA
CTACACGGACACCACGTTCTGTTTCTGCTTCCTCGACCATCGATGCAATG
GGGCCAGCGGCCTACAAACGTCCGCCGTAATCGGTCTTCTCACTCTAATT
CCTGCCCTGCTTCTACGCTAGAATCTCCTCTTGAGTGCAGTATTTAAGTG
CCTTACTAACTCGCTCTGCAACTACGAATTCCGTCCAACATTCCACACTT
TTTGTACAACCTTTTGACATGACTACAGCTTTTAGAGTCTTGTGTTTACT
CAACTAATTAAATACATTTTACCATATTTATAAACAGGAAAAAAAAAAAA
AAAAAAA

GH23035.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG6038-RA 838 CG6038-RA 30..768 1..739 3695 100 Plus
mtTFB1.a 1502 mtTFB1.a 1437..1502 739..674 330 100 Minus
CG42630-RA 1578 CG42630-RA 1514..1578 739..675 325 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11701384..11701829 738..293 2230 100 Minus
chr3L 24539361 chr3L 11702097..11702249 153..1 765 100 Minus
chr3L 24539361 chr3L 11701885..11702026 293..152 710 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:03:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11710506..11710952 739..293 2235 100 Minus
3L 28110227 3L 11711220..11711372 153..1 765 100 Minus
3L 28110227 3L 11711008..11711149 293..152 710 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11703606..11704052 739..293 2235 100 Minus
3L 28103327 3L 11704320..11704472 153..1 765 100 Minus
3L 28103327 3L 11704108..11704249 293..152 710 100 Minus
Blast to na_te.dros performed on 2019-03-17 00:05:51 has no hits.

GH23035.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:06:37 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11701885..11702025 153..293 100 <- Minus
chr3L 11702098..11702249 1..152 100   Minus
chr3L 11701384..11701828 294..738 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:53:16 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
CG6038-RA 1..477 95..571 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:41:28 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
crim-RA 1..477 95..571 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:57:42 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
crim-RA 1..477 95..571 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:33:29 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
CG6038-RA 1..477 95..571 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:11:41 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
crim-RA 1..477 95..571 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:15:27 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
CG6038-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:41:28 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
crim-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:57:42 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
crim-RA 15..752 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:33:29 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
CG6038-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:11:41 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
crim-RA 15..752 1..738 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:37 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11711008..11711148 153..293 100 <- Minus
3L 11711221..11711372 1..152 100   Minus
3L 11710507..11710951 294..738 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:37 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11711008..11711148 153..293 100 <- Minus
3L 11711221..11711372 1..152 100   Minus
3L 11710507..11710951 294..738 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:37 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11711008..11711148 153..293 100 <- Minus
3L 11711221..11711372 1..152 100   Minus
3L 11710507..11710951 294..738 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:57:42 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11703607..11704051 294..738 100 <- Minus
arm_3L 11704108..11704248 153..293 100 <- Minus
arm_3L 11704321..11704472 1..152 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:05:52 Download gff for GH23035.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11703607..11704051 294..738 100 <- Minus
3L 11704108..11704248 153..293 100 <- Minus
3L 11704321..11704472 1..152 100   Minus

GH23035.hyp Sequence

Translation from 94 to 570

> GH23035.hyp
MHYHTNLIAALLLAALIHEGSAIWCYRCTSATPGCAEKFNWRGIGFLGEH
CPEPDDICVKVTERRGARETITRDCLSALSFRKDIPADKYEGCRPAAHDE
KLANYVNHTIKEHDVRRDYYTDTTFCFCFLDHRCNGASGLQTSAVIGLLT
LIPALLLR*

GH23035.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
crim-PA 158 CG6038-PA 1..158 1..158 867 100 Plus

GH23035.pep Sequence

Translation from 94 to 570

> GH23035.pep
MHYHTNLIAALLLAALIHEGSAIWCYRCTSATPGCAEKFNWRGIGFLGEH
CPEPDDICVKVTERRGARETITRDCLSALSFRKDIPADKYEGCRPAAHDE
KLANYVNHTIKEHDVRRDYYTDTTFCFCFLDHRCNGASGLQTSAVIGLLT
LIPALLLR*

GH23035.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24521-PA 156 GF24521-PA 5..155 6..156 687 81.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13894-PA 158 GG13894-PA 1..158 1..158 750 94.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16386-PA 162 GH16386-PA 16..141 16..141 590 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
crim-PA 158 CG6038-PA 1..158 1..158 867 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11580-PA 159 GI11580-PA 1..143 1..143 638 79.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16339-PA 159 GL16339-PA 1..157 1..157 653 81.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19312-PA 159 GA19312-PA 18..157 18..157 649 84.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24719-PA 158 GM24719-PA 1..158 1..158 820 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12781-PA 158 GD12781-PA 1..158 1..158 822 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11259-PA 164 GJ11259-PA 1..143 1..143 619 81.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12396-PA 160 GK12396-PA 15..155 14..156 603 76.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20185-PA 158 GE20185-PA 1..158 1..158 747 94.3 Plus