BDGP Sequence Production Resources |
Search the DGRC for GH23338
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 233 |
Well: | 38 |
Vector: | pOT2 |
Associated Gene/Transcript | CG9875-RA |
Protein status: | GH23338.pep: gold |
Preliminary Size: | 612 |
Sequenced Size: | 632 |
Gene | Date | Evidence |
---|---|---|
CG9875 | 2002-01-01 | Sim4 clustering to Release 2 |
CG9875 | 2002-05-18 | Blastp of sequenced clone |
CG9875 | 2008-04-29 | Release 5.5 accounting |
CG9875 | 2008-08-15 | Release 5.9 accounting |
CG9875 | 2008-12-18 | 5.12 accounting |
632 bp (632 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118813
> GH23338.complete TCCAGCCTTTTCGAAAAATCCGTAACTTTTCGTATGTGTTCCATACTCGC ACGTGCAAGGATGTTTTGTGCAGGAATAGTGCAGCGTAGACTGAGCATGG GTCTCAATCCAAAACTCGGCCTGGCGCCCAGGAAGCTCTACTCCGAGGAG AAGAAGCCCCCGGGTGTTTTCCTTTGGGGCGGCGGACTTGGCAAGCTGCA GGGCGGTCTCAAGGAGGAGGAGTACTTCATTTCGTTGACCCAAACCCTCG TGGGCAAGATGCGGGACAAGAAGGAGCCCGGCGACTACCTGCCCAACTGG GACGAGTTCCAGAAGACTCTGGACCACGCCTCGCTGGGCAGCACCTCTTC CATGAACAAGCACAAGAACGTACTCGAGGAGGCCTTTTTCCTGAACAAGA CTGCAGACGACATCAAATTATTGCACGATCGTGCCCAAGAAGAGCTCAAA TCTCGCCATACTGCCACAGAACTGGAACTCGAATCAGATCCCCAGAACAC CAAATAGTTAGTTGTTTATGTTTAAATGCCATACACCGATTTCTTCAGGC GCATCATCATCATAATCACCCAACTTATCCACATGACACGGCTCAATAAA ATTGTTAGTTGCAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 19244207..19244492 | 114..399 | 1430 | 100 | Plus |
chr2R | 21145070 | chr2R | 19244552..19244766 | 398..612 | 1075 | 100 | Plus |
chr2R | 21145070 | chr2R | 19244036..19244148 | 1..113 | 565 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 23357893..23358178 | 114..399 | 1430 | 100 | Plus |
2R | 25286936 | 2R | 23358238..23358454 | 398..614 | 1085 | 100 | Plus |
2R | 25286936 | 2R | 23357722..23357834 | 1..113 | 565 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 23359092..23359377 | 114..399 | 1430 | 100 | Plus |
2R | 25260384 | 2R | 23359437..23359653 | 398..614 | 1085 | 100 | Plus |
2R | 25260384 | 2R | 23358921..23359033 | 1..113 | 565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 19244036..19244148 | 1..113 | 100 | -> | Plus |
chr2R | 19244207..19244492 | 114..399 | 100 | -> | Plus |
chr2R | 19244554..19244766 | 400..612 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9875-RA | 1..474 | 34..507 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9875-RB | 1..474 | 34..507 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9875-RA | 1..474 | 34..507 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9875-RA | 1..474 | 34..507 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9875-RA | 1..474 | 34..507 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9875-RA | 44..655 | 1..612 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9875-RA | 63..674 | 1..612 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9875-RA | 63..674 | 1..612 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9875-RA | 44..655 | 1..612 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9875-RA | 63..674 | 1..612 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23357722..23357834 | 1..113 | 100 | -> | Plus |
2R | 23357893..23358178 | 114..399 | 100 | -> | Plus |
2R | 23358240..23358452 | 400..612 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23357722..23357834 | 1..113 | 100 | -> | Plus |
2R | 23357893..23358178 | 114..399 | 100 | -> | Plus |
2R | 23358240..23358452 | 400..612 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23357722..23357834 | 1..113 | 100 | -> | Plus |
2R | 23357893..23358178 | 114..399 | 100 | -> | Plus |
2R | 23358240..23358452 | 400..612 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 19245245..19245357 | 1..113 | 100 | -> | Plus |
arm_2R | 19245416..19245701 | 114..399 | 100 | -> | Plus |
arm_2R | 19245763..19245975 | 400..612 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23359110..23359395 | 114..399 | 100 | -> | Plus |
2R | 23359457..23359669 | 400..612 | 100 | Plus | |
2R | 23358939..23359051 | 1..113 | 100 | -> | Plus |
Translation from 0 to 506
> GH23338.hyp SSLFEKSVTFRMCSILARARMFCAGIVQRRLSMGLNPKLGLAPRKLYSEE KKPPGVFLWGGGLGKLQGGLKEEEYFISLTQTLVGKMRDKKEPGDYLPNW DEFQKTLDHASLGSTSSMNKHKNVLEEAFFLNKTADDIKLLHDRAQEELK SRHTATELELESDPQNTK*
Translation from 33 to 506
> GH23338.pep MCSILARARMFCAGIVQRRLSMGLNPKLGLAPRKLYSEEKKPPGVFLWGG GLGKLQGGLKEEEYFISLTQTLVGKMRDKKEPGDYLPNWDEFQKTLDHAS LGSTSSMNKHKNVLEEAFFLNKTADDIKLLHDRAQEELKSRHTATELELE SDPQNTK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13138-PA | 158 | GF13138-PA | 1..134 | 4..137 | 439 | 70.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22844-PA | 157 | GG22844-PA | 1..157 | 1..157 | 590 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20342-PA | 113 | GH20342-PA | 1..83 | 55..134 | 182 | 43.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9875-PB | 157 | CG9875-PB | 1..157 | 1..157 | 821 | 100 | Plus |
CG9875-PA | 157 | CG9875-PA | 1..157 | 1..157 | 821 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20010-PA | 120 | GI20010-PA | 1..113 | 30..137 | 214 | 46.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11440-PA | 149 | GL11440-PA | 1..127 | 10..140 | 295 | 53.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22089-PA | 149 | GA22089-PA | 1..127 | 10..140 | 283 | 53.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16001-PA | 148 | GM16001-PA | 1..148 | 10..157 | 664 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11754-PA | 157 | GD11754-PA | 1..157 | 1..157 | 714 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22916-PA | 148 | GK22916-PA | 1..130 | 10..140 | 329 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14280-PA | 157 | GE14280-PA | 1..157 | 1..157 | 587 | 80.3 | Plus |