Clone GH23338 Report

Search the DGRC for GH23338

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:233
Well:38
Vector:pOT2
Associated Gene/TranscriptCG9875-RA
Protein status:GH23338.pep: gold
Preliminary Size:612
Sequenced Size:632

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9875 2002-01-01 Sim4 clustering to Release 2
CG9875 2002-05-18 Blastp of sequenced clone
CG9875 2008-04-29 Release 5.5 accounting
CG9875 2008-08-15 Release 5.9 accounting
CG9875 2008-12-18 5.12 accounting

Clone Sequence Records

GH23338.complete Sequence

632 bp (632 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118813

> GH23338.complete
TCCAGCCTTTTCGAAAAATCCGTAACTTTTCGTATGTGTTCCATACTCGC
ACGTGCAAGGATGTTTTGTGCAGGAATAGTGCAGCGTAGACTGAGCATGG
GTCTCAATCCAAAACTCGGCCTGGCGCCCAGGAAGCTCTACTCCGAGGAG
AAGAAGCCCCCGGGTGTTTTCCTTTGGGGCGGCGGACTTGGCAAGCTGCA
GGGCGGTCTCAAGGAGGAGGAGTACTTCATTTCGTTGACCCAAACCCTCG
TGGGCAAGATGCGGGACAAGAAGGAGCCCGGCGACTACCTGCCCAACTGG
GACGAGTTCCAGAAGACTCTGGACCACGCCTCGCTGGGCAGCACCTCTTC
CATGAACAAGCACAAGAACGTACTCGAGGAGGCCTTTTTCCTGAACAAGA
CTGCAGACGACATCAAATTATTGCACGATCGTGCCCAAGAAGAGCTCAAA
TCTCGCCATACTGCCACAGAACTGGAACTCGAATCAGATCCCCAGAACAC
CAAATAGTTAGTTGTTTATGTTTAAATGCCATACACCGATTTCTTCAGGC
GCATCATCATCATAATCACCCAACTTATCCACATGACACGGCTCAATAAA
ATTGTTAGTTGCAAAAAAAAAAAAAAAAAAAA

GH23338.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG9875-RA 798 CG9875-RA 131..744 1..614 3070 100 Plus
CG9875-RB 613 CG9875-RB 44..550 1..507 2535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19244207..19244492 114..399 1430 100 Plus
chr2R 21145070 chr2R 19244552..19244766 398..612 1075 100 Plus
chr2R 21145070 chr2R 19244036..19244148 1..113 565 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:04:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23357893..23358178 114..399 1430 100 Plus
2R 25286936 2R 23358238..23358454 398..614 1085 100 Plus
2R 25286936 2R 23357722..23357834 1..113 565 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23359092..23359377 114..399 1430 100 Plus
2R 25260384 2R 23359437..23359653 398..614 1085 100 Plus
2R 25260384 2R 23358921..23359033 1..113 565 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:29:19 has no hits.

GH23338.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:30:01 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19244036..19244148 1..113 100 -> Plus
chr2R 19244207..19244492 114..399 100 -> Plus
chr2R 19244554..19244766 400..612 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:53:43 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG9875-RA 1..474 34..507 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:01 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG9875-RB 1..474 34..507 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:44:38 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG9875-RA 1..474 34..507 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:17 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG9875-RA 1..474 34..507 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:17:44 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG9875-RA 1..474 34..507 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:21:33 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG9875-RA 44..655 1..612 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:01 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG9875-RA 63..674 1..612 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:44:38 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG9875-RA 63..674 1..612 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:18 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG9875-RA 44..655 1..612 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:17:44 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG9875-RA 63..674 1..612 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:30:01 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23357722..23357834 1..113 100 -> Plus
2R 23357893..23358178 114..399 100 -> Plus
2R 23358240..23358452 400..612 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:30:01 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23357722..23357834 1..113 100 -> Plus
2R 23357893..23358178 114..399 100 -> Plus
2R 23358240..23358452 400..612 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:30:01 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23357722..23357834 1..113 100 -> Plus
2R 23357893..23358178 114..399 100 -> Plus
2R 23358240..23358452 400..612 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:44:38 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19245245..19245357 1..113 100 -> Plus
arm_2R 19245416..19245701 114..399 100 -> Plus
arm_2R 19245763..19245975 400..612 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:39 Download gff for GH23338.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23359110..23359395 114..399 100 -> Plus
2R 23359457..23359669 400..612 100   Plus
2R 23358939..23359051 1..113 100 -> Plus

GH23338.hyp Sequence

Translation from 0 to 506

> GH23338.hyp
SSLFEKSVTFRMCSILARARMFCAGIVQRRLSMGLNPKLGLAPRKLYSEE
KKPPGVFLWGGGLGKLQGGLKEEEYFISLTQTLVGKMRDKKEPGDYLPNW
DEFQKTLDHASLGSTSSMNKHKNVLEEAFFLNKTADDIKLLHDRAQEELK
SRHTATELELESDPQNTK*

GH23338.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG9875-PB 157 CG9875-PB 1..157 12..168 821 100 Plus
CG9875-PA 157 CG9875-PA 1..157 12..168 821 100 Plus

GH23338.pep Sequence

Translation from 33 to 506

> GH23338.pep
MCSILARARMFCAGIVQRRLSMGLNPKLGLAPRKLYSEEKKPPGVFLWGG
GLGKLQGGLKEEEYFISLTQTLVGKMRDKKEPGDYLPNWDEFQKTLDHAS
LGSTSSMNKHKNVLEEAFFLNKTADDIKLLHDRAQEELKSRHTATELELE
SDPQNTK*

GH23338.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13138-PA 158 GF13138-PA 1..134 4..137 439 70.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22844-PA 157 GG22844-PA 1..157 1..157 590 81.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20342-PA 113 GH20342-PA 1..83 55..134 182 43.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9875-PB 157 CG9875-PB 1..157 1..157 821 100 Plus
CG9875-PA 157 CG9875-PA 1..157 1..157 821 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20010-PA 120 GI20010-PA 1..113 30..137 214 46.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11440-PA 149 GL11440-PA 1..127 10..140 295 53.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22089-PA 149 GA22089-PA 1..127 10..140 283 53.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16001-PA 148 GM16001-PA 1..148 10..157 664 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11754-PA 157 GD11754-PA 1..157 1..157 714 95.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22916-PA 148 GK22916-PA 1..130 10..140 329 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14280-PA 157 GE14280-PA 1..157 1..157 587 80.3 Plus