BDGP Sequence Production Resources |
Search the DGRC for GH23780
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 237 |
Well: | 80 |
Vector: | pOT2 |
Associated Gene/Transcript | CG11455-RD |
Protein status: | GH23780.pep: gold |
Preliminary Size: | 797 |
Sequenced Size: | 633 |
Gene | Date | Evidence |
---|---|---|
CG3436 | 2001-01-01 | Release 2 assignment |
CG11455 | 2001-01-01 | Release 2 assignment |
CG11455 | 2001-11-29 | Blastp of sequenced clone |
CG11455 | 2008-04-29 | Release 5.5 accounting |
CG11455 | 2008-08-15 | Release 5.9 accounting |
CG11455 | 2008-12-18 | 5.12 accounting |
633 bp (633 high quality bases) assembled on 2001-11-29
GenBank Submission: AY069186
> GH23780.complete TGACAGTCTTGTTTTTGTGCTGGAATTAAGGCAATATAAGACAATTCCTT GGGTATTGCCAACAATTTAAGGTGTGTGATCAGGATATACTCTACTTAAC GTTGTAGAGAATACATTGAAATTCTTGGGGGCCAGAGACTGCTAACGGCT TGAAGGCTTAAACCCCTTGTTTATTGTTACGTCACAGTGTGTGTGCTTCG CTCCACAGACAAAATGTCGCTTACCCCCTTTCTACGCCTGCCCTTAACCG ATCTGACCGGGTGCCTAATTAACCACCAGACCTACGACAAGTGCGGAAAA TTCGAGATGAAAATGATGGAGTGCTTCGAGGCCTATGGCCTGGAGCGTGG AAAACGGGAGTGCGCCGACCTGATCTCCGACTTTCAGGAGTGCGTCGGCA TGCAGAAGCAACTGATGCGCTTCCATGCAATGCGAAACGAACGCTACAAG CAGTGGCTCAAGGGGGAGCGTAAGGGACAAGAATTTTTTGCGGATCCCCC ACGCGTTGATGCCTACTAGACGGAGACCCGTTTTTCTTGGTTAGTTTCAC ATTGTAAAACTGCAAATTGTGTAAAAATAAAATGAGAAACAATTCTGGTA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11455-RB | 625 | CG11455-RB | 27..625 | 1..599 | 2995 | 100 | Plus |
CG3436.a | 2082 | CG3436.a | 17..443 | 1..427 | 2135 | 100 | Plus |
CG3436.b | 1209 | CG3436.b | 17..443 | 1..427 | 2135 | 100 | Plus |
CG3436.a | 2082 | CG3436.a | 509..692 | 420..603 | 890 | 98.9 | Plus |
CG3436.b | 1209 | CG3436.b | 509..692 | 420..603 | 890 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3S18 | 6126 | 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). | 1161..1212 | 290..341 | 107 | 67.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 155895..156067 | 427..599 | 100 | Plus | |
chr2L | 155396..155821 | 1..426 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11455-RB | 1..306 | 214..519 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11455-RC | 1..306 | 214..519 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11455-RG | 1..306 | 214..519 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11455-RB | 1..306 | 214..519 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11455-RG | 1..306 | 214..519 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11455-RB | 23..608 | 1..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11455-RB | 27..625 | 1..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11455-RB | 25..623 | 1..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11455-RB | 23..608 | 1..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11455-RB | 25..623 | 1..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 155359..155784 | 1..426 | 100 | -> | Plus |
2L | 155858..156030 | 427..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 155359..155784 | 1..426 | 100 | -> | Plus |
2L | 155858..156030 | 427..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 155359..155784 | 1..426 | 100 | -> | Plus |
2L | 155858..156030 | 427..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 155359..155784 | 1..426 | 100 | -> | Plus |
arm_2L | 155858..156030 | 427..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 155359..155784 | 1..426 | 100 | -> | Plus |
2L | 155858..156030 | 427..599 | 100 | Plus |
Translation from 213 to 518
> GH23780.hyp MSLTPFLRLPLTDLTGCLINHQTYDKCGKFEMKMMECFEAYGLERGKREC ADLISDFQECVGMQKQLMRFHAMRNERYKQWLKGERKGQEFFADPPRVDA Y*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11455-PK | 101 | CG11455-PK | 1..101 | 1..101 | 554 | 100 | Plus |
CG11455-PJ | 101 | CG11455-PJ | 1..101 | 1..101 | 554 | 100 | Plus |
CG11455-PG | 101 | CG11455-PG | 1..101 | 1..101 | 554 | 100 | Plus |
CG11455-PF | 101 | CG11455-PF | 1..101 | 1..101 | 554 | 100 | Plus |
CG11455-PD | 101 | CG11455-PD | 1..101 | 1..101 | 554 | 100 | Plus |
Translation from 213 to 518
> GH23780.pep MSLTPFLRLPLTDLTGCLINHQTYDKCGKFEMKMMECFEAYGLERGKREC ADLISDFQECVGMQKQLMRFHAMRNERYKQWLKGERKGQEFFADPPRVDA Y*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20695-PA | 101 | GF20695-PA | 1..101 | 1..101 | 519 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24700-PA | 101 | GG24700-PA | 1..101 | 1..101 | 538 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH25231-PA | 101 | GH25231-PA | 1..101 | 1..101 | 483 | 86.1 | Plus |
Dgri\GH11536-PA | 101 | GH11536-PA | 1..101 | 1..101 | 483 | 86.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ND-15-PK | 101 | CG11455-PK | 1..101 | 1..101 | 554 | 100 | Plus |
ND-15-PJ | 101 | CG11455-PJ | 1..101 | 1..101 | 554 | 100 | Plus |
ND-15-PG | 101 | CG11455-PG | 1..101 | 1..101 | 554 | 100 | Plus |
ND-15-PF | 101 | CG11455-PF | 1..101 | 1..101 | 554 | 100 | Plus |
ND-15-PD | 101 | CG11455-PD | 1..101 | 1..101 | 554 | 100 | Plus |
ND-15-PC | 101 | CG11455-PC | 1..101 | 1..101 | 554 | 100 | Plus |
ND-15-PB | 101 | CG11455-PB | 1..101 | 1..101 | 554 | 100 | Plus |
ND-15-PA | 101 | CG11455-PA | 1..101 | 1..101 | 554 | 100 | Plus |
ND-15-PI | 70 | CG11455-PI | 1..70 | 32..101 | 383 | 100 | Plus |
ND-15-PH | 70 | CG11455-PH | 1..70 | 32..101 | 383 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17027-PA | 101 | GI17027-PA | 1..101 | 1..101 | 490 | 87.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18846-PA | 101 | GL18846-PA | 1..101 | 1..101 | 490 | 89.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11014-PA | 101 | GA11014-PA | 1..101 | 1..101 | 490 | 89.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16718-PA | 101 | GM16718-PA | 1..101 | 1..101 | 542 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23004-PA | 101 | GD23004-PA | 1..101 | 1..101 | 542 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24570-PA | 101 | GJ24570-PA | 1..101 | 1..101 | 484 | 87.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23910-PA | 101 | GK23910-PA | 1..101 | 1..101 | 485 | 87.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16615-PA | 101 | GE16615-PA | 1..101 | 1..101 | 542 | 100 | Plus |