Clone GH23780 Report

Search the DGRC for GH23780

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:237
Well:80
Vector:pOT2
Associated Gene/TranscriptCG11455-RD
Protein status:GH23780.pep: gold
Preliminary Size:797
Sequenced Size:633

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3436 2001-01-01 Release 2 assignment
CG11455 2001-01-01 Release 2 assignment
CG11455 2001-11-29 Blastp of sequenced clone
CG11455 2008-04-29 Release 5.5 accounting
CG11455 2008-08-15 Release 5.9 accounting
CG11455 2008-12-18 5.12 accounting

Clone Sequence Records

GH23780.complete Sequence

633 bp (633 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069186

> GH23780.complete
TGACAGTCTTGTTTTTGTGCTGGAATTAAGGCAATATAAGACAATTCCTT
GGGTATTGCCAACAATTTAAGGTGTGTGATCAGGATATACTCTACTTAAC
GTTGTAGAGAATACATTGAAATTCTTGGGGGCCAGAGACTGCTAACGGCT
TGAAGGCTTAAACCCCTTGTTTATTGTTACGTCACAGTGTGTGTGCTTCG
CTCCACAGACAAAATGTCGCTTACCCCCTTTCTACGCCTGCCCTTAACCG
ATCTGACCGGGTGCCTAATTAACCACCAGACCTACGACAAGTGCGGAAAA
TTCGAGATGAAAATGATGGAGTGCTTCGAGGCCTATGGCCTGGAGCGTGG
AAAACGGGAGTGCGCCGACCTGATCTCCGACTTTCAGGAGTGCGTCGGCA
TGCAGAAGCAACTGATGCGCTTCCATGCAATGCGAAACGAACGCTACAAG
CAGTGGCTCAAGGGGGAGCGTAAGGGACAAGAATTTTTTGCGGATCCCCC
ACGCGTTGATGCCTACTAGACGGAGACCCGTTTTTCTTGGTTAGTTTCAC
ATTGTAAAACTGCAAATTGTGTAAAAATAAAATGAGAAACAATTCTGGTA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH23780.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG11455-RB 625 CG11455-RB 27..625 1..599 2995 100 Plus
CG3436.a 2082 CG3436.a 17..443 1..427 2135 100 Plus
CG3436.b 1209 CG3436.b 17..443 1..427 2135 100 Plus
CG3436.a 2082 CG3436.a 509..692 420..603 890 98.9 Plus
CG3436.b 1209 CG3436.b 509..692 420..603 890 98.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 155396..155822 1..427 2120 99.8 Plus
chr2L 23010047 chr2L 155888..156067 420..599 870 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:05:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 155359..155785 1..427 2135 100 Plus
2L 23513712 2L 155851..156034 420..603 890 98.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 155359..155785 1..427 2135 100 Plus
2L 23513712 2L 155851..156034 420..603 890 98.9 Plus
Blast to na_te.dros performed 2019-03-16 07:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 1161..1212 290..341 107 67.3 Plus

GH23780.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:38:30 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 155895..156067 427..599 100   Plus
chr2L 155396..155821 1..426 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:54:22 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
CG11455-RB 1..306 214..519 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:27:27 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
CG11455-RC 1..306 214..519 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:02:01 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
CG11455-RG 1..306 214..519 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:55:02 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
CG11455-RB 1..306 214..519 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:38:11 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
CG11455-RG 1..306 214..519 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:04:18 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
CG11455-RB 23..608 1..586 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:27:27 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
CG11455-RB 27..625 1..599 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:02:01 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
CG11455-RB 25..623 1..599 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:55:02 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
CG11455-RB 23..608 1..586 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:38:11 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
CG11455-RB 25..623 1..599 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:30 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
2L 155359..155784 1..426 100 -> Plus
2L 155858..156030 427..599 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:30 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
2L 155359..155784 1..426 100 -> Plus
2L 155858..156030 427..599 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:30 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
2L 155359..155784 1..426 100 -> Plus
2L 155858..156030 427..599 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:02:01 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 155359..155784 1..426 100 -> Plus
arm_2L 155858..156030 427..599 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:31:03 Download gff for GH23780.complete
Subject Subject Range Query Range Percent Splice Strand
2L 155359..155784 1..426 100 -> Plus
2L 155858..156030 427..599 100   Plus

GH23780.hyp Sequence

Translation from 213 to 518

> GH23780.hyp
MSLTPFLRLPLTDLTGCLINHQTYDKCGKFEMKMMECFEAYGLERGKREC
ADLISDFQECVGMQKQLMRFHAMRNERYKQWLKGERKGQEFFADPPRVDA
Y*

GH23780.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG11455-PK 101 CG11455-PK 1..101 1..101 554 100 Plus
CG11455-PJ 101 CG11455-PJ 1..101 1..101 554 100 Plus
CG11455-PG 101 CG11455-PG 1..101 1..101 554 100 Plus
CG11455-PF 101 CG11455-PF 1..101 1..101 554 100 Plus
CG11455-PD 101 CG11455-PD 1..101 1..101 554 100 Plus

GH23780.pep Sequence

Translation from 213 to 518

> GH23780.pep
MSLTPFLRLPLTDLTGCLINHQTYDKCGKFEMKMMECFEAYGLERGKREC
ADLISDFQECVGMQKQLMRFHAMRNERYKQWLKGERKGQEFFADPPRVDA
Y*

GH23780.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20695-PA 101 GF20695-PA 1..101 1..101 519 94.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24700-PA 101 GG24700-PA 1..101 1..101 538 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25231-PA 101 GH25231-PA 1..101 1..101 483 86.1 Plus
Dgri\GH11536-PA 101 GH11536-PA 1..101 1..101 483 86.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
ND-15-PK 101 CG11455-PK 1..101 1..101 554 100 Plus
ND-15-PJ 101 CG11455-PJ 1..101 1..101 554 100 Plus
ND-15-PG 101 CG11455-PG 1..101 1..101 554 100 Plus
ND-15-PF 101 CG11455-PF 1..101 1..101 554 100 Plus
ND-15-PD 101 CG11455-PD 1..101 1..101 554 100 Plus
ND-15-PC 101 CG11455-PC 1..101 1..101 554 100 Plus
ND-15-PB 101 CG11455-PB 1..101 1..101 554 100 Plus
ND-15-PA 101 CG11455-PA 1..101 1..101 554 100 Plus
ND-15-PI 70 CG11455-PI 1..70 32..101 383 100 Plus
ND-15-PH 70 CG11455-PH 1..70 32..101 383 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17027-PA 101 GI17027-PA 1..101 1..101 490 87.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18846-PA 101 GL18846-PA 1..101 1..101 490 89.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11014-PA 101 GA11014-PA 1..101 1..101 490 89.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16718-PA 101 GM16718-PA 1..101 1..101 542 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:22:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23004-PA 101 GD23004-PA 1..101 1..101 542 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24570-PA 101 GJ24570-PA 1..101 1..101 484 87.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23910-PA 101 GK23910-PA 1..101 1..101 485 87.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16615-PA 101 GE16615-PA 1..101 1..101 542 100 Plus