Clone GH23865 Report

Search the DGRC for GH23865

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:238
Well:65
Vector:pOT2
Associated Gene/TranscriptCG7655-RA
Protein status:GH23865.pep: gold
Preliminary Size:1111
Sequenced Size:983

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7655 2001-01-01 Release 2 assignment
CG7655 2001-10-10 Blastp of sequenced clone
CG7655 2003-01-01 Sim4 clustering to Release 3
CG7655 2008-04-29 Release 5.5 accounting
CG7655 2008-08-15 Release 5.9 accounting
CG7655 2008-12-18 5.12 accounting

Clone Sequence Records

GH23865.complete Sequence

983 bp (983 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060774

> GH23865.complete
CGTTCATTGAATTTGTTTTGATTATCTCGAAATAACAAGCTATTTTCTCA
ATTTTCCTGACAAAAATGACATCGATTGCCAAGTCCATAGTACTATTGGC
ATCCCTGGCCACGTTCGCTTACTCCCTGTACGTGGTTGGCAGCCTGATGA
TGTTCCTTTCGACGCCTCGTTCGATTTCCAAGGCGCACACCTGGATTTTC
AATTTACTGGACAACAAGTCGCGCCTGCAGACCGCCTATGGACCCGTGGT
GTTCGATACCCTCTACCTGATCGGATTCATCTTCCAGCACAGCTTCCTCA
AGTCAGCCGTGGTCAAGAAGCTGTTGGCCAAGTTGGGATTGTCGGGTGCG
GAGCGCACTATTTATAGCCTGACGTCATCGCTTTGTTTACATTATTTGAT
CGTCAACTGGCTGCCCGCTCAGTCGATTGTTCTGTGGCAAATCGATGTGG
AGCAGAGTGCTCCGCTTTGGTGGACCTTCGTGATCACCCATGGCATCTGC
TGGGTTGTCATCTTTGGCGGCAGTTTGGTGATGGATCTGCCAGAGCTGCT
GGGCGTCAAGCAAGCCTACTACGATCTGAAGGCCTACGGACCGCCCATCA
GCTACAAATCCGGGGAATTGCGCAATCTGTACGCCCATGTCAGACATCCC
TCGTTTGTGGGCCTGTCGGTCATCCTGTTCGCCACGAATGTGATGAGCGT
GGATCGGCTAGTCATGGCCTTGCTGCTGACCACCTACATGTACCTGGCCT
GGTCCACAGATCAGAAGGATGTGGCCTATCAGAAGATTCAACTGCAGCGC
AAGAAACTCGAACTGAAGGCCAAGTAAACTTAATCTCAAAAGTGTTCTTA
CTAAGATCTAGTTGTAAGTTGACATGAGTTTGTATTGAATAATACTTTTC
TAACAATTTCAGTTTCCGAATCAGAACGAAACAAATAATGAAAAAACTAA
AAGATATATAAAAATAAAAAAAAAAAAAAAAAA

GH23865.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG7655-RA 1133 CG7655-RA 155..1120 1..966 4830 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13507514..13508086 393..965 2835 99.7 Plus
chr3R 27901430 chr3R 13507063..13507454 1..392 1960 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:05:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17683175..17683748 393..966 2870 100 Plus
3R 32079331 3R 17682724..17683115 1..392 1960 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17424006..17424579 393..966 2870 100 Plus
3R 31820162 3R 17423555..17423946 1..392 1960 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:25:53 has no hits.

GH23865.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:27:02 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13507063..13507454 1..392 100 -> Plus
chr3R 13507514..13508086 393..965 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:54:31 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
CG7655-RA 1..762 66..827 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:50 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
CG7655-RA 1..762 66..827 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:58:09 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
CG7655-RA 1..762 66..827 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:26:01 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
CG7655-RA 1..762 66..827 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:37:30 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
CG7655-RA 1..762 66..827 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:53 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
CG7655-RA 54..1018 1..965 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:49 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
CG7655-RA 54..1018 1..965 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:58:09 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
CG7655-RA 56..1020 1..965 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:26:01 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
CG7655-RA 54..1018 1..965 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:37:30 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
CG7655-RA 56..1020 1..965 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:02 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17682724..17683115 1..392 100 -> Plus
3R 17683175..17683747 393..965 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:02 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17682724..17683115 1..392 100 -> Plus
3R 17683175..17683747 393..965 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:02 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17682724..17683115 1..392 100 -> Plus
3R 17683175..17683747 393..965 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:58:09 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13508446..13508837 1..392 100 -> Plus
arm_3R 13508897..13509469 393..965 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:03:10 Download gff for GH23865.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17423555..17423946 1..392 100 -> Plus
3R 17424006..17424578 393..965 100   Plus

GH23865.pep Sequence

Translation from 65 to 826

> GH23865.pep
MTSIAKSIVLLASLATFAYSLYVVGSLMMFLSTPRSISKAHTWIFNLLDN
KSRLQTAYGPVVFDTLYLIGFIFQHSFLKSAVVKKLLAKLGLSGAERTIY
SLTSSLCLHYLIVNWLPAQSIVLWQIDVEQSAPLWWTFVITHGICWVVIF
GGSLVMDLPELLGVKQAYYDLKAYGPPISYKSGELRNLYAHVRHPSFVGL
SVILFATNVMSVDRLVMALLLTTYMYLAWSTDQKDVAYQKIQLQRKKLEL
KAK*

GH23865.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17825-PA 253 GF17825-PA 1..253 1..253 1124 83.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22437-PA 253 GG22437-PA 1..253 1..253 1286 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14928-PA 253 GH14928-PA 1..253 1..253 961 71.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG7655-PA 253 CG7655-PA 1..253 1..253 1292 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11446-PA 253 GI11446-PA 1..252 1..252 966 72.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22123-PA 253 GL22123-PA 1..253 1..253 1063 79.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20505-PA 253 GA20505-PA 1..253 1..253 1063 79.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15257-PA 253 GM15257-PA 1..253 1..253 1308 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19182-PA 101 GD19182-PA 1..99 1..99 491 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13642-PA 253 GJ13642-PA 1..252 1..252 991 75.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13493-PA 253 GK13493-PA 1..238 1..238 980 73.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25492-PA 253 GE25492-PA 1..253 1..253 1243 92.5 Plus

GH23865.hyp Sequence

Translation from 65 to 826

> GH23865.hyp
MTSIAKSIVLLASLATFAYSLYVVGSLMMFLSTPRSISKAHTWIFNLLDN
KSRLQTAYGPVVFDTLYLIGFIFQHSFLKSAVVKKLLAKLGLSGAERTIY
SLTSSLCLHYLIVNWLPAQSIVLWQIDVEQSAPLWWTFVITHGICWVVIF
GGSLVMDLPELLGVKQAYYDLKAYGPPISYKSGELRNLYAHVRHPSFVGL
SVILFATNVMSVDRLVMALLLTTYMYLAWSTDQKDVAYQKIQLQRKKLEL
KAK*

GH23865.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7655-PA 253 CG7655-PA 1..253 1..253 1292 100 Plus