Clone GH23934 Report

Search the DGRC for GH23934

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:239
Well:34
Vector:pOT2
Associated Gene/TranscriptCG10570-RA
Protein status:GH23934.pep: gold
Preliminary Size:2626
Sequenced Size:828

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10570 2001-01-01 Release 2 assignment
CG10570 2001-12-12 Blastp of sequenced clone
CG10570 2003-01-01 Sim4 clustering to Release 3
CG10570 2008-04-29 Release 5.5 accounting
CG10570 2008-08-15 Release 5.9 accounting
CG10570 2008-12-18 5.12 accounting

Clone Sequence Records

GH23934.complete Sequence

828 bp (828 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070522

> GH23934.complete
TCCAGAGCAGAGCAGATCGGTAACGAGCTGAACGGAGCGTGAGCTGTGAA
ATTTCCTTTCTTTTCCATCCAATGTGCAATTTGCAAAAGTTTTGTGTCAA
TGCCAAAAATTAGCCACACGGATTCCAAACAAAAATTGTTGAAGCAAGCA
AGATTGGGCAAACATCTGTCATCGAAAAAAGGATCACGTACTGGAAACTC
GGCCAACAACAAGGAACTTAAAGTACTCACCCTGTTGCAAACTGTACCGT
GAACTTTGACTTCTCTACAAACGCATTGGAAGCGCAGCTTTGTGTAATCG
GCAGAAAATTGTACCTATTCAAAAAGAAGGAAGCTATCTAGATCTAGAGA
CAAAATGGTCTACACCGAACGTACCGACAAGTGCCTGAGCAGCACCACAA
AGGACAACCAGTCCACGAAGGGTCAGAACCACTCCAAGTCGAGCAGCGGC
TCTGGATCGGGTTCGGGATCAGGATCGGGATCTTGGAGCAGTCAAGCATC
GAGTGCTGACAAGTGGAAGTACAACAACATGGTGAAAACCGATCGCCAGC
AATTCAATGGGATGCATTTCTCCTAAATGCTTTAGTAGATCCCATTGAAA
TGTTCCTCTAGGAATGTGGTGATCCTTGAGAAACGGGGAAGCTGGGGGCT
GATAACGTTGTTATTTCTATTTGGTTCAGCAGGGCCGCTTTAGGTTAGTT
TTGTAAGCCATTTTATAGACTTATTCATTGCTATGTGATAAAAGAAAAGA
AATCATTAATCAATCAATTGGCTAAAAAATTAAATCAGAAGAAGATGCGC
CAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH23934.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG10570-RA 817 CG10570-RA 17..817 1..801 4005 100 Plus
CG42502-RA 817 CG42502-RA 17..817 1..801 4005 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18808822..18809472 801..151 3150 98.9 Minus
chr2L 23010047 chr2L 18809603..18809754 152..1 760 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:05:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18810029..18810686 808..151 3290 100 Minus
2L 23513712 2L 18810819..18810970 152..1 760 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18810029..18810686 808..151 3290 100 Minus
2L 23513712 2L 18810819..18810970 152..1 760 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:20:45 has no hits.

GH23934.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:21:41 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18808822..18809470 153..801 98 <- Minus
chr2L 18809603..18809754 1..152 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:54:34 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
CG10570-RA 1..222 355..576 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:18:00 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
CG10570-RA 1..222 355..576 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:26 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
CG10570-RA 1..222 355..576 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:44:05 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
CG10570-RA 1..222 355..576 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:06:19 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
CG10570-RA 1..222 355..576 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:50:50 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
CG10570-RA 17..817 1..801 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:18:00 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
CG42502-RA 17..817 1..801 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:26 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
CG10570-RB 283..1083 1..801 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:44:06 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
CG10570-RA 17..817 1..801 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:06:19 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
CG42502-RC 17..817 1..801 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:21:41 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18810036..18810684 153..801 100 <- Minus
2L 18810819..18810970 1..152 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:21:41 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18810036..18810684 153..801 100 <- Minus
2L 18810819..18810970 1..152 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:21:41 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18810036..18810684 153..801 100 <- Minus
2L 18810819..18810970 1..152 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:26 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18810036..18810684 153..801 100 <- Minus
arm_2L 18810819..18810970 1..152 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:20:20 Download gff for GH23934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18810036..18810684 153..801 100 <- Minus
2L 18810819..18810970 1..152 100   Minus

GH23934.hyp Sequence

Translation from 354 to 575

> GH23934.hyp
MVYTERTDKCLSSTTKDNQSTKGQNHSKSSSGSGSGSGSGSGSWSSQASS
ADKWKYNNMVKTDRQQFNGMHFS*

GH23934.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG10570-PB 73 CG10570-PB 1..73 1..73 387 100 Plus
CG10570-PC 73 CG10570-PC 1..73 1..73 387 100 Plus
CG10570-PA 73 CG10570-PA 1..73 1..73 387 100 Plus

GH23934.pep Sequence

Translation from 354 to 575

> GH23934.pep
MVYTERTDKCLSSTTKDNQSTKGQNHSKSSSGSGSGSGSGSGSWSSQASS
ADKWKYNNMVKTDRQQFNGMHFS*

GH23934.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14487-PA 72 GF14487-PA 1..72 1..73 194 72.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21683-PA 81 GG21683-PA 1..81 1..73 217 80.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10049-PA 69 GH10049-PA 1..69 1..73 169 57.5 Plus
Dgri\GH11198-PA 69 GH11198-PA 1..69 1..73 169 57.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG10570-PB 73 CG10570-PB 1..73 1..73 387 100 Plus
CG10570-PC 73 CG10570-PC 1..73 1..73 387 100 Plus
CG10570-PA 73 CG10570-PA 1..73 1..73 387 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18119-PA 76 GI18119-PA 1..76 1..73 139 63.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18689-PA 78 GL18689-PA 1..78 1..73 196 65.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10402-PA 78 GA10402-PA 1..78 1..73 193 65.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17062-PA 73 GM17062-PA 1..73 1..73 359 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21808-PA 73 GD21808-PA 1..73 1..73 359 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17744-PA 67 GJ17744-PA 1..67 1..73 148 65.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15534-PA 64 GK15534-PA 1..64 1..73 175 52.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12704-PA 73 GE12704-PA 1..73 1..73 359 98.6 Plus