Clone GH23965 Report

Search the DGRC for GH23965

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:239
Well:65
Vector:pOT2
Associated Gene/TranscriptCpr11B-RA
Protein status:GH23965.pep: gold
Preliminary Size:1026
Sequenced Size:820

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2555 2001-01-01 Release 2 assignment
CG2555 2001-10-10 Blastp of sequenced clone
CG2555 2003-01-01 Sim4 clustering to Release 3
Cpr11B 2008-04-29 Release 5.5 accounting
Cpr11B 2008-08-15 Release 5.9 accounting
Cpr11B 2008-12-18 5.12 accounting

Clone Sequence Records

GH23965.complete Sequence

820 bp (820 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060775

> GH23965.complete
CGTTCCCAGATCGAGAATTCGCCACCATAATCCATCTATATATCATATTA
ATTTTTTTTTTTTTCAAGTGACTTGTGTGATCTGTGATTTTTGTTGAAAG
CGCGAAAATGCTGCGACCTCTGTTGACCGTTGCCCTTGTACTTTTCGGCT
TTTCCTCGGCCATTTTGGCCGGTCGTCTTAGCCAACGGTATTTGCCCACT
CCGCAGGCGAGTCAGCTGCACTACCATGGTGTAAGTGGCCAAGGACAGGC
TCGTCCTGGCGCAGGACATTCCTTTGGAGGCGGCTCCAGCTACCAGCGAC
AGCAACAACCACAAATTCCCATCGTTAGGAGCGATTATAACAGCGACGCC
AATGGCAACTACAACTTCGGTTTTGACACTGGTAATGGTATTCACCGCGA
TGAGACCGGTGAGTTCCGCGGTGGTTGGCCCCACGGATCGCTGGGCGTCC
AGGGATCCTACTCATACACTGGGGATGATGGCAAGCAGTACACGGTGAAC
TACACGGCCGATAAGAACGGATTCCATGCCGAAGGTGCCCATCTACCCGT
TTCGCCCTCGGTTCCCGCTGCTCCAGCTGGACGCAGCTCTTATGGCGCTG
GTGGATCTGGCTACCGTGGATCGGCTTCATCGCATGTCCCAGCTGCTGCT
CCTGCCACCCGATATCTGCCACCAGGATATCGCCAGCGCAGGCACTACTA
AGTGATATAATCGATGAGATGGACAGGAGCGCCTACGAGCCAGTAATCTG
CTATTAACACTGTAAATTTCAATAAATTGACACTTCTTTTGGTAATTTTG
GAAAAAAAAAAAAAAAAAAA

GH23965.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr11B-RA 963 Cpr11B-RA 55..858 1..805 3985 99.8 Plus
Cpr11B.a 812 Cpr11B.a 13..810 1..805 3870 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 12444079..12444445 1..370 1755 98.9 Plus
chrX 22417052 chrX 12444950..12445171 580..801 1095 99.5 Plus
chrX 22417052 chrX 12444556..12444766 370..580 1055 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:05:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12553142..12553510 1..370 1800 99.7 Plus
X 23542271 X 12554014..12554239 580..805 1130 100 Plus
X 23542271 X 12553621..12553831 370..580 1055 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12561240..12561608 1..370 1810 99.7 Plus
X 23527363 X 12562112..12562337 580..805 1130 100 Plus
X 23527363 X 12561719..12561929 370..580 1055 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:24:33 has no hits.

GH23965.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:30 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 12444079..12444445 1..370 98 -> Plus
chrX 12444557..12444766 371..580 100 -> Plus
chrX 12444951..12445171 581..801 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:54:39 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11B-RA 1..594 108..701 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:51 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11B-RA 1..594 108..701 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:23 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11B-RA 1..594 108..701 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:26:02 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11B-RA 1..594 108..701 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:17:16 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11B-RA 1..594 108..701 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:54 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11B-RA 13..812 1..801 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:51 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11B-RA 13..812 1..801 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:23 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11B-RA 19..818 1..801 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:26:02 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11B-RA 13..812 1..801 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:17:16 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11B-RA 19..818 1..801 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:30 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
X 12553142..12553510 1..370 99 -> Plus
X 12553622..12553831 371..580 100 -> Plus
X 12554015..12554235 581..801 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:30 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
X 12553142..12553510 1..370 99 -> Plus
X 12553622..12553831 371..580 100 -> Plus
X 12554015..12554235 581..801 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:30 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
X 12553142..12553510 1..370 99 -> Plus
X 12553622..12553831 371..580 100 -> Plus
X 12554015..12554235 581..801 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:23 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12448048..12448268 581..801 100   Plus
arm_X 12447175..12447543 1..370 99 -> Plus
arm_X 12447655..12447864 371..580 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:03:12 Download gff for GH23965.complete
Subject Subject Range Query Range Percent Splice Strand
X 12561240..12561608 1..370 99 -> Plus
X 12561720..12561929 371..580 100 -> Plus
X 12562113..12562333 581..801 100   Plus

GH23965.hyp Sequence

Translation from 107 to 700

> GH23965.hyp
MLRPLLTVALVLFGFSSAILAGRLSQRYLPTPQASQLHYHGVSGQGQARP
GAGHSFGGGSSYQRQQQPQIPIVRSDYNSDANGNYNFGFDTGNGIHRDET
GEFRGGWPHGSLGVQGSYSYTGDDGKQYTVNYTADKNGFHAEGAHLPVSP
SVPAAPAGRSSYGAGGSGYRGSASSHVPAAAPATRYLPPGYRQRRHY*

GH23965.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr11B-PA 197 CG2555-PA 1..197 1..197 1063 100 Plus
Cpr11B-PB 195 CG2555-PB 1..195 1..197 1041 99 Plus
Cpr47Ea-PA 135 CG9079-PA 22..129 47..157 207 40.2 Plus
Cpr47Ef-PD 601 CG13214-PD 93..249 40..171 202 35 Plus
Cpr65Az-PA 239 CG12330-PA 84..217 32..171 196 31 Plus

GH23965.pep Sequence

Translation from 107 to 700

> GH23965.pep
MLRPLLTVALVLFGFSSAILAGRLSQRYLPTPQASQLHYHGVSGQGQARP
GAGHSFGGGSSYQRQQQPQIPIVRSDYNSDANGNYNFGFDTGNGIHRDET
GEFRGGWPHGSLGVQGSYSYTGDDGKQYTVNYTADKNGFHAEGAHLPVSP
SVPAAPAGRSSYGAGGSGYRGSASSHVPAAAPATRYLPPGYRQRRHY*

GH23965.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21375-PA 195 GF21375-PA 1..195 1..197 818 83.9 Plus
Dana\GF10921-PA 101 GF10921-PA 17..99 66..150 193 45.3 Plus
Dana\GF23526-PA 115 GF23526-PA 35..114 72..151 190 48.8 Plus
Dana\GF23520-PA 108 GF23520-PA 29..104 72..147 174 45.5 Plus
Dana\GF23521-PA 109 GF23521-PA 40..106 85..150 174 49.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17726-PA 197 GG17726-PA 1..197 1..197 973 96.4 Plus
Dere\GG22686-PA 135 GG22686-PA 43..127 72..155 201 47.1 Plus
Dere\GG14082-PA 107 GG14082-PA 38..105 84..150 182 50 Plus
Dere\GG14079-PA 106 GG14079-PA 38..104 85..150 176 47.8 Plus
Dere\GG15326-PA 109 GG15326-PA 28..106 72..150 176 45 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24127-PA 206 GH24127-PA 1..206 1..197 591 65.7 Plus
Dgri\GH15846-PA 106 GH15846-PA 26..104 72..150 200 51.9 Plus
Dgri\GH15845-PA 106 GH15845-PA 26..104 72..150 200 51.9 Plus
Dgri\GH21943-PA 175 GH21943-PA 82..157 72..146 182 46.1 Plus
Dgri\GH15650-PA 101 GH15650-PA 17..97 67..147 181 44.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr11B-PA 197 CG2555-PA 1..197 1..197 1063 100 Plus
Cpr11B-PB 195 CG2555-PB 1..195 1..197 1041 99 Plus
Cpr47Ea-PA 135 CG9079-PA 22..129 47..157 207 40.2 Plus
Cpr47Ef-PD 601 CG13214-PD 93..249 40..171 202 35 Plus
Cpr47Ef-PC 612 CG13214-PC 93..249 40..171 202 35 Plus
Cpr65Az-PA 239 CG12330-PA 84..217 32..171 196 31 Plus
Cpr49Aa-PB 144 CG30045-PB 31..143 70..195 186 32.3 Plus
Cpr65Ax2-PB 102 CG18777-PB 18..100 68..150 180 41.7 Plus
Cpr65Ax2-PA 102 CG18777-PA 18..100 68..150 180 41.7 Plus
Cpr65Ax1-PA 102 CG34270-PA 18..100 68..150 180 41.7 Plus
Cpr49Ae-PA 134 CG8505-PA 22..117 63..155 178 39.2 Plus
Lcp65Ac-PA 109 CG6956-PA 40..106 85..150 173 49.3 Plus
Cpr78Cc-PA 119 CG7658-PA 28..104 72..155 172 41.2 Plus
Cpr49Ah-PA 190 CG8515-PA 45..136 64..153 172 38 Plus
Lcp65Af-PA 100 CG10533-PA 31..100 84..152 170 41.4 Plus
Lcp65Ad-PB 108 CG6955-PB 24..104 67..147 166 41.5 Plus
Lcp65Ad-PA 108 CG6955-PA 24..104 67..147 166 41.5 Plus
Cpr65Av-PA 111 CG32405-PA 33..109 72..147 166 41.6 Plus
Cpr65Aw-PA 117 CG32404-PA 28..104 72..147 164 41.6 Plus
Cpr47Ee-PA 369 CG13222-PA 98..218 63..189 160 32.8 Plus
Lcp65Ae-PA 99 CG10529-PA 18..98 67..149 159 40.5 Plus
Cpr49Af-PB 126 CG8510-PB 23..106 73..155 158 35.7 Plus
Cpr49Af-PA 126 CG8510-PA 23..106 73..155 158 35.7 Plus
Lcp65Ag3-PA 105 CG18779-PA 21..103 66..150 157 38.4 Plus
Edg78E-PB 122 CG7673-PB 25..100 73..154 157 38.1 Plus
Edg78E-PA 122 CG7673-PA 25..100 73..154 157 38.1 Plus
Cpr65Au-PB 106 CG18778-PB 35..99 78..140 155 44.6 Plus
Cpr65Au-PA 106 CG18778-PA 35..99 78..140 155 44.6 Plus
Pcp-PA 184 CG3440-PA 19..103 59..150 155 34.8 Plus
Lcp65Ag2-PA 105 CG10534-PA 21..103 66..150 154 37.2 Plus
Lcp65Ag1-PA 105 CG10530-PA 21..103 66..150 154 37.2 Plus
Acp65Aa-PA 105 CG10297-PA 21..104 67..147 150 36.9 Plus
Cpr65Ec-PA 127 CG8634-PA 30..104 76..155 148 39 Plus
Cpr67Fa2-PA 134 CG18349-PA 17..105 58..155 148 32.7 Plus
Cpr67Fa1-PA 134 CG7941-PA 17..105 58..155 148 32.7 Plus
Cpr49Ab-PA 259 CG30042-PA 113..241 14..153 147 30 Plus
Cpr65Aw-PB 86 CG32404-PB 14..73 89..147 145 45 Plus
Cpr49Ag-PA 134 CG8511-PA 40..133 72..150 144 37.2 Plus
Lcp65Aa-PA 102 CG7287-PA 30..100 75..147 141 36.5 Plus
Cpr67Fb-PA 122 CG18348-PA 36..100 82..153 140 38.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16384-PA 189 GI16384-PA 1..189 1..197 535 63.1 Plus
Dmoj\GI12627-PA 112 GI12627-PA 25..110 65..150 194 46.6 Plus
Dmoj\GI19650-PA 136 GI19650-PA 43..118 72..146 175 44.7 Plus
Dmoj\GI12628-PA 104 GI12628-PA 23..104 66..149 174 42.4 Plus
Dmoj\GI12618-PA 110 GI12618-PA 39..107 83..150 171 50.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15780-PA 182 GL15780-PA 1..171 1..155 549 70.2 Plus
Dper\GL15556-PA 108 GL15556-PA 24..104 67..147 175 46.3 Plus
Dper\GL15557-PA 109 GL15557-PA 40..106 85..150 174 50.7 Plus
Dper\GL15515-PA 111 GL15515-PA 30..109 69..147 171 42.5 Plus
Dper\GL15560-PA 102 GL15560-PA 22..100 69..147 170 41.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15392-PA 215 GA15392-PA 1..215 1..197 627 70.5 Plus
Dpse\GA19981-PA 108 GA19981-PA 24..104 67..147 175 46.3 Plus
Dpse\GA19982-PA 109 GA19982-PA 40..106 85..150 174 50.7 Plus
Dpse\GA16877-PA 111 GA16877-PA 30..109 69..147 171 42.5 Plus
Dpse\GA23851-PA 104 GA23851-PA 21..103 69..151 170 42.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11570-PA 197 GM11570-PA 1..197 1..197 993 98.5 Plus
Dsec\GM14760-PA 109 GM14760-PA 28..106 72..150 183 46.2 Plus
Dsec\GM19678-PA 109 GM19678-PA 28..106 72..150 183 46.2 Plus
Dsec\GM20461-PA 598 GM20461-PA 137..225 68..155 177 41.6 Plus
Dsec\GM13862-PA 101 GM13862-PA 21..100 70..149 171 43.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24794-PA 197 GD24794-PA 1..197 1..197 986 98 Plus
Dsim\GD13939-PA 107 GD13939-PA 22..104 68..150 179 44 Plus
Dsim\GD25930-PA 617 GD25930-PA 137..225 68..155 176 41.6 Plus
Dsim\GD14949-PA 120 GD14949-PA 28..104 72..155 169 42.4 Plus
Dsim\GD13146-PA 108 GD13146-PA 28..104 72..147 162 42.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16758-PA 229 GJ16758-PA 1..229 1..197 534 57.4 Plus
Dvir\GJ12740-PA 110 GJ12740-PA 29..107 72..150 186 51.2 Plus
Dvir\GJ12680-PA 105 GJ12680-PA 20..103 67..150 185 41.2 Plus
Dvir\GJ12681-PA 105 GJ12681-PA 20..103 67..150 185 41.2 Plus
Dvir\GJ15017-PA 137 GJ15017-PA 43..118 72..146 175 44.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16500-PA 209 GK16500-PA 6..209 8..197 604 66 Plus
Dwil\GK20648-PA 137 GK20648-PA 44..123 72..150 179 42.5 Plus
Dwil\GK17266-PA 115 GK17266-PA 31..111 67..147 176 43.9 Plus
Dwil\GK17269-PA 108 GK17269-PA 39..105 85..150 174 49.3 Plus
Dwil\GK16921-PA 105 GK16921-PA 25..105 72..152 172 39 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17016-PA 197 GE17016-PA 1..197 1..197 908 95.9 Plus
Dyak\GE13038-PA 649 GE13038-PA 164..252 70..157 173 41.6 Plus
Dyak\GE21543-PA 108 GE21543-PA 24..104 67..147 169 43.9 Plus
Dyak\GE13041-PA 135 GE13041-PA 43..118 72..146 169 43.4 Plus
Dyak\GE20506-PA 108 GE20506-PA 28..104 72..147 166 46.2 Plus