Clone GH24271 Report

Search the DGRC for GH24271

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:242
Well:71
Vector:pOT2
Associated Gene/TranscriptFmo-1-RA
Protein status:GH24271.pep: gold
Preliminary Size:1541
Sequenced Size:1453

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3006 2001-01-01 Release 2 assignment
CG3006 2001-07-04 Blastp of sequenced clone
CG3006 2003-01-01 Sim4 clustering to Release 3
Fmo-1 2008-04-29 Release 5.5 accounting
Fmo-1 2008-08-15 Release 5.9 accounting
Fmo-1 2008-12-18 5.12 accounting

Clone Sequence Records

GH24271.complete Sequence

1453 bp (1453 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051603

> GH24271.complete
GCGTGTAGAAAGCAATCCCGGCCTATCTCACTTAGGATCGCAGCTAGCAA
TTAAAATTAATATAAGCTGTAACCAATACTGTAATATGATGAGCGTTTGC
ATAATTGGGGCCGGAACCGCGGGTCTTTGCTGTGCCCGCCATTCGATTGC
AAATGGGTTCGAGACCACTGTGTTCGAGCTATCTGACCGAATCGGCGGCA
CCTGGGTTTACAATGAGGCAACAGGGGCGGTCAATGGCATCGATGTCCAC
AGCAGCATGTACAAGAACCTACGAACCAACCTGCCCAAGGAGGTAATGGG
CTTCCCGGACTTCGAAATCGGGGCAAACGAGGCTTCCTATGTGAGATCCG
ACGAGATCTGCGACTTCCTTAACCAATACGCGAACCATTTCGACCTGAAG
AAGCACATCAAGTTCGATAGCTATGTGATTCGAGTTTTGCAGAGGAAAAC
AAAGTGGCAAGTACTTTTCAAAGACTTGGTCACCAACAAGATAGAGTTCC
AGTACTTCGACAAGGTCTTGGTGGCCAATGGCCACTACCACACTCCGAAT
TATAGCCAAATTCCGAATATGGAAAGGTTTAAAGGGCAGTTCCTGCACAG
CCACGACTTCAGAAGTAGGGAGGTTTTCGAAGGTAAATCCGTTCTGGTCA
TTGGAGCTGGTCCCAGTGGCATGGACCTGTCGAACATCATTTCCCGAACG
GCGGATCGGGTCACCATAAGTCACCACTTGACCGATATCGGGCAACACTC
ATTCTTCGAGAACGTACAGCAGAAACCCGATGTGCGGGAGCTCGATGAGA
AGGGAGCCTTTTTCGTGGACGGATCGTACCAGGAGTTCGACACCGTCTTC
TTTTGCACAGGTTACAAGTACGCCTTTCCCTTCCTGACCGTCGACTCGGG
CATCTATGTGGAGGACAACTACGTCCAGGAGCTGTACAAGCAGTGCATCA
ACATCAGGAACCCATCCATGGCTCTGATCGGACTGCCGTTTTACGTTTGT
GCCGCCCAAATGATGGACATCCAAGCGAGGTTCATCATGAGCTACTACAA
CGGATCCAACGAGTTGCCGTCCACGGAGGATATGCTCAAGGACACCCGCG
ATAGGATGGGCAAACTGTGGGCGGAGGGACTAAGAAAACGCCATGCCCAC
ATGCTGGGTCCCAAGCAAATCGACTATTTCACGGACTTGTCGCAAACTGC
AGGAGTTAAGAACATCAAGCCTGTGATGACCAAATTGCACAACGAAAGCA
GCAAGTGCTTCAATGAGAATTTGCTCCACTTCCGGGAGGACAATTTCGCG
ATTCTGGACGACGAGACATTCATTAAACTCAACTAGATCCTGAATCAATC
AATAGGAGCATTAGATTCCAAAACATCGTTTTTGGACTTCCCTTCGAAAT
AAAATAAATTTCCAATTCTTGTATTCCAAAACAACAAAAAAAAAAAAAAA
AAA

GH24271.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
Fmo-1-RA 1562 Fmo-1-RA 117..1552 1..1436 7180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19849851..19850389 630..1168 2680 99.8 Plus
chr2R 21145070 chr2R 19849054..19849326 1..273 1350 99.6 Plus
chr2R 21145070 chr2R 19850454..19850717 1169..1432 1215 97.3 Plus
chr2R 21145070 chr2R 19849385..19849575 273..463 955 100 Plus
chr2R 21145070 chr2R 19849621..19849800 457..636 855 98.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:05:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23963772..23964310 630..1168 2695 100 Plus
2R 25286936 2R 23962975..23963247 1..273 1365 100 Plus
2R 25286936 2R 23964375..23964642 1169..1436 1340 100 Plus
2R 25286936 2R 23963306..23963496 273..463 955 100 Plus
2R 25286936 2R 23963542..23963721 457..636 885 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23964971..23965509 630..1168 2695 100 Plus
2R 25260384 2R 23964174..23964446 1..273 1365 100 Plus
2R 25260384 2R 23965574..23965841 1169..1436 1340 100 Plus
2R 25260384 2R 23964505..23964695 273..463 955 100 Plus
2R 25260384 2R 23964741..23964920 457..636 885 99.4 Plus
Blast to na_te.dros performed on 2019-03-16 23:45:05 has no hits.

GH24271.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:46:13 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19849054..19849326 1..273 99 -> Plus
chr2R 19849386..19849572 274..460 100 -> Plus
chr2R 19849625..19849796 461..632 98 -> Plus
chr2R 19849854..19850389 633..1168 99 -> Plus
chr2R 19850454..19850720 1169..1435 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:54:54 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
Fmo-1-RA 1..1251 86..1336 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:23:50 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
Fmo-1-RA 1..1251 86..1336 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:01 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
Fmo-1-RA 1..1251 86..1336 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:56:38 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
Fmo-1-RA 1..1251 86..1336 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:57:48 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
Fmo-1-RA 1..1251 86..1336 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:21:39 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
Fmo-1-RA 1..1435 1..1435 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:23:50 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
Fmo-1-RA 1..1435 1..1435 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:01 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
Fmo-1-RA 20..1454 1..1435 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:56:39 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
Fmo-1-RA 1..1435 1..1435 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:57:48 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
Fmo-1-RA 20..1454 1..1435 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:13 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23962975..23963247 1..273 100 -> Plus
2R 23963307..23963493 274..460 100 -> Plus
2R 23963546..23963717 461..632 100 -> Plus
2R 23963775..23964310 633..1168 100 -> Plus
2R 23964375..23964641 1169..1435 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:13 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23962975..23963247 1..273 100 -> Plus
2R 23963307..23963493 274..460 100 -> Plus
2R 23963546..23963717 461..632 100 -> Plus
2R 23963775..23964310 633..1168 100 -> Plus
2R 23964375..23964641 1169..1435 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:13 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23962975..23963247 1..273 100 -> Plus
2R 23963307..23963493 274..460 100 -> Plus
2R 23963546..23963717 461..632 100 -> Plus
2R 23963775..23964310 633..1168 100 -> Plus
2R 23964375..23964641 1169..1435 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:01 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19851898..19852164 1169..1435 100   Plus
arm_2R 19850498..19850770 1..273 100 -> Plus
arm_2R 19850830..19851016 274..460 100 -> Plus
arm_2R 19851069..19851240 461..632 100 -> Plus
arm_2R 19851298..19851833 633..1168 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:34:23 Download gff for GH24271.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23964192..23964464 1..273 100 -> Plus
2R 23964524..23964710 274..460 100 -> Plus
2R 23964763..23964934 461..632 100 -> Plus
2R 23964992..23965527 633..1168 100 -> Plus
2R 23965592..23965858 1169..1435 100   Plus

GH24271.hyp Sequence

Translation from 0 to 1335

> GH24271.hyp
RVESNPGLSHLGSQLAIKINISCNQYCNMMSVCIIGAGTAGLCCARHSIA
NGFETTVFELSDRIGGTWVYNEATGAVNGIDVHSSMYKNLRTNLPKEVMG
FPDFEIGANEASYVRSDEICDFLNQYANHFDLKKHIKFDSYVIRVLQRKT
KWQVLFKDLVTNKIEFQYFDKVLVANGHYHTPNYSQIPNMERFKGQFLHS
HDFRSREVFEGKSVLVIGAGPSGMDLSNIISRTADRVTISHHLTDIGQHS
FFENVQQKPDVRELDEKGAFFVDGSYQEFDTVFFCTGYKYAFPFLTVDSG
IYVEDNYVQELYKQCINIRNPSMALIGLPFYVCAAQMMDIQARFIMSYYN
GSNELPSTEDMLKDTRDRMGKLWAEGLRKRHAHMLGPKQIDYFTDLSQTA
GVKNIKPVMTKLHNESSKCFNENLLHFREDNFAILDDETFIKLN*

GH24271.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Fmo-1-PA 416 CG3006-PA 1..416 29..444 2214 100 Plus
Fmo-2-PA 429 CG3174-PA 11..423 32..442 969 44.1 Plus

GH24271.pep Sequence

Translation from 85 to 1335

> GH24271.pep
MMSVCIIGAGTAGLCCARHSIANGFETTVFELSDRIGGTWVYNEATGAVN
GIDVHSSMYKNLRTNLPKEVMGFPDFEIGANEASYVRSDEICDFLNQYAN
HFDLKKHIKFDSYVIRVLQRKTKWQVLFKDLVTNKIEFQYFDKVLVANGH
YHTPNYSQIPNMERFKGQFLHSHDFRSREVFEGKSVLVIGAGPSGMDLSN
IISRTADRVTISHHLTDIGQHSFFENVQQKPDVRELDEKGAFFVDGSYQE
FDTVFFCTGYKYAFPFLTVDSGIYVEDNYVQELYKQCINIRNPSMALIGL
PFYVCAAQMMDIQARFIMSYYNGSNELPSTEDMLKDTRDRMGKLWAEGLR
KRHAHMLGPKQIDYFTDLSQTAGVKNIKPVMTKLHNESSKCFNENLLHFR
EDNFAILDDETFIKLN*

GH24271.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12882-PA 416 GF12882-PA 1..416 1..416 1882 79.8 Plus
Dana\GF13806-PA 425 GF13806-PA 7..419 4..414 977 45.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22910-PA 415 GG22910-PA 1..415 2..416 2121 92.5 Plus
Dere\GG10818-PA 429 GG10818-PA 11..423 4..414 978 43.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20181-PA 370 GH20181-PA 1..361 2..362 1405 67.3 Plus
Dgri\GH22902-PA 427 GH22902-PA 9..424 1..414 960 43.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Fmo-1-PA 416 CG3006-PA 1..416 1..416 2214 100 Plus
Fmo-2-PA 429 CG3174-PA 11..423 4..414 969 44.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20708-PA 415 GI20708-PA 1..415 2..416 1622 67.7 Plus
Dmoj\GI18387-PA 427 GI18387-PA 9..424 1..414 992 44.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11186-PA 415 GL11186-PA 1..415 2..416 1912 82.2 Plus
Dper\GL20239-PA 432 GL20239-PA 14..426 4..414 981 44.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16437-PA 432 GA16437-PA 14..426 4..414 981 44.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16071-PA 416 GM16071-PA 1..416 1..416 2202 96.4 Plus
Dsec\GM20867-PA 429 GM20867-PA 11..423 4..414 982 43.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10319-PA 429 GD10319-PA 11..423 4..414 982 43.8 Plus
Dsim\GD15455-PA 158 GD15455-PA 1..155 1..157 749 89.2 Plus
Dsim\GD15456-PA 84 GD15456-PA 1..84 333..416 450 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21889-PA 415 GJ21889-PA 1..415 2..416 1587 67.2 Plus
Dvir\GJ21464-PA 427 GJ21464-PA 9..424 1..414 967 43.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15849-PA 415 GK15849-PA 1..415 2..416 1733 73.7 Plus
Dwil\GK15848-PA 415 GK15848-PA 1..415 2..416 1641 70.4 Plus
Dwil\GK19621-PA 427 GK19621-PA 12..424 4..414 1003 45.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14348-PA 415 GE14348-PA 1..415 2..416 2115 92.8 Plus
Dyak\GE24665-PA 428 GE24665-PA 11..423 4..414 978 44.1 Plus