Clone GH24548 Report

Search the DGRC for GH24548

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:245
Well:48
Vector:pOT2
Associated Gene/TranscriptCG1958-RA
Protein status:GH24548.pep: gold
Preliminary Size:833
Sequenced Size:952

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1958 2002-01-01 Sim4 clustering to Release 2
CG1958 2002-05-18 Blastp of sequenced clone
CG1958 2003-01-01 Sim4 clustering to Release 3
CG1958 2008-04-29 Release 5.5 accounting
CG1958 2008-08-15 Release 5.9 accounting
CG1958 2008-12-18 5.12 accounting

Clone Sequence Records

GH24548.complete Sequence

952 bp (952 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118817

> GH24548.complete
TTTATATACCTTCGTTTTTCGTCTTTTTTCTAGAAACGAACAAAATTTAA
AGTCAACAAAATCTCCATTGTGCTTTACTTTTCTGCTAAACATGTCGAAG
GCAACAAAGCTGCGATTCGCACTGATCACCGAGGATGTGCTGGACAAGCT
GAGGCCTCGCTCACAGTCGGAAAATGCACGATCGAAGTACATGAATGAAA
TATATGAGGCCATTAGGATGGCGGTCAACGAGGTTGTGGACGAGAAGATG
GAGCAGCTGAATGATACAGTTAATCGAATGGTTGAGGAGCGGGTGAGCAA
AATTCTGGACCATCACTTGACCAAGGGATCGTTGACGGGGCGCAGTAGCT
CAGTTGGAAGGAAAAGGGATTTGGATAATAGGGAAATCAAGGGAGCAAGG
TATGCTGCTCCAGCCACATCAATTAGTTCCCTAAAAGTTTCCAATCTCAA
ACGTGGCCGAAGCAAGAGGCAAAATCCCACCAAAGAGCATGTGACCTTCG
CCTCCGACGATCAGTTGACTAAAAGGTCTAGGACCAAGGCGCAGAAAATC
ACTGTAATGCCCATACATCGCGAGAGCCAGGTGAAAAGTACTCCCTCGTA
CGGCGACAGCAACCACAACAACACACCGATGCAAACACCTTCACCACCAC
TTAGCACGGATTGCAATAAGCTGGATGAGGACGATTACTATAACTTCTCT
GATGTGGAGGAACCCTCGATTCTAAGCATGGCTGCTAGGTATCTCAAGAA
ACTCGAAGATGCCCGCCGTCGAAAGCACGCACAATAGCTTAGGTAGCCTG
TACTTCAAACTTTCGTAGATACTTCTTCATATTTCTCGTCAACTCGTCAA
CTCAATTTTCAAAGTGAGCGTGTATATATACCATTAAAACAATGGATTCG
GTAAAAAAAAAAACTAAATAAATTAACCGAAAATAAAAAAAAAAAAAAAA
AA

GH24548.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG1958-RA 978 CG1958-RA 47..978 1..932 4660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7158881..7159814 1..934 4670 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:06:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7266950..7267885 1..936 4680 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7275048..7275983 1..936 4680 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:41:05 has no hits.

GH24548.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:41:57 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7158881..7159814 1..934 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:55:09 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
CG1958-RA 1..696 92..787 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:45:49 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
CG1958-RA 1..696 92..787 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:11 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
CG1958-RA 1..696 92..787 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:08 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
CG1958-RA 1..696 92..787 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:16:44 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
CG1958-RA 1..696 92..787 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:21:18 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
CG1958-RA 47..978 1..932 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:45:49 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
CG1958-RA 47..978 1..932 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:11 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
CG1958-RA 47..980 1..934 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:08 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
CG1958-RA 47..978 1..932 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:16:44 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
CG1958-RA 47..980 1..934 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:41:57 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
X 7266950..7267883 1..934 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:41:57 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
X 7266950..7267883 1..934 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:41:57 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
X 7266950..7267883 1..934 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:11 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7160983..7161916 1..934 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:26 Download gff for GH24548.complete
Subject Subject Range Query Range Percent Splice Strand
X 7275048..7275981 1..934 100   Plus

GH24548.hyp Sequence

Translation from 0 to 786

> GH24548.hyp
LYTFVFRLFSRNEQNLKSTKSPLCFTFLLNMSKATKLRFALITEDVLDKL
RPRSQSENARSKYMNEIYEAIRMAVNEVVDEKMEQLNDTVNRMVEERVSK
ILDHHLTKGSLTGRSSSVGRKRDLDNREIKGARYAAPATSISSLKVSNLK
RGRSKRQNPTKEHVTFASDDQLTKRSRTKAQKITVMPIHRESQVKSTPSY
GDSNHNNTPMQTPSPPLSTDCNKLDEDDYYNFSDVEEPSILSMAARYLKK
LEDARRRKHAQ*

GH24548.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG1958-PA 231 CG1958-PA 1..231 31..261 1170 100 Plus

GH24548.pep Sequence

Translation from 91 to 786

> GH24548.pep
MSKATKLRFALITEDVLDKLRPRSQSENARSKYMNEIYEAIRMAVNEVVD
EKMEQLNDTVNRMVEERVSKILDHHLTKGSLTGRSSSVGRKRDLDNREIK
GARYAAPATSISSLKVSNLKRGRSKRQNPTKEHVTFASDDQLTKRSRTKA
QKITVMPIHRESQVKSTPSYGDSNHNNTPMQTPSPPLSTDCNKLDEDDYY
NFSDVEEPSILSMAARYLKKLEDARRRKHAQ*

GH24548.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20936-PA 283 GF20936-PA 1..268 1..228 413 42.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19636-PA 226 GG19636-PA 1..224 1..229 807 74.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG1958-PA 231 CG1958-PA 1..231 1..231 1170 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15942-PA 199 GI15942-PA 10..89 6..86 140 41.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14691-PA 244 GL14691-PA 1..145 1..161 166 32.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15152-PA 244 GA15152-PA 1..145 1..161 170 35.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17511-PA 232 GM17511-PA 1..230 1..230 1009 86.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16838-PA 232 GD16838-PA 1..230 1..230 1016 87.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14848-PA 220 GJ14848-PA 10..80 6..75 142 39.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16387-PA 236 GK16387-PA 1..229 1..228 203 30 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15706-PA 239 GE15706-PA 1..239 1..231 880 76.2 Plus