BDGP Sequence Production Resources |
Search the DGRC for GH24739
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 247 |
Well: | 39 |
Vector: | pOT2 |
Associated Gene/Transcript | CG6852-RA |
Protein status: | GH24739.pep: gold |
Preliminary Size: | 478 |
Sequenced Size: | 496 |
Gene | Date | Evidence |
---|---|---|
CG6852 | 2002-01-01 | Sim4 clustering to Release 2 |
CG6852 | 2002-05-18 | Blastp of sequenced clone |
CG6852 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6852 | 2008-04-29 | Release 5.5 accounting |
CG6852 | 2008-08-15 | Release 5.9 accounting |
CG6852 | 2008-12-18 | 5.12 accounting |
496 bp (496 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118819
> GH24739.complete CCGCATTGCCCCCCAAGTTTCCGTACCCCCTCCTGGATTTCGAGCTTATG GGTGCAGTTGGATCCGCTTTGAGATCCCCAATAGTCGACATGTCCACCAA GCAGGCGAAATTCGTTGAAAACACCATTGCCAGCAACAAAGTGGTGATAT TCAGCAAGACCTACTGTCCCTACTGCACGATGGCCAAAGAGCCCTTCAAA AAGCTCAATGTGGACGCCACCATAATAGAACTCGATGGAAATCCCGATGG CAACGAAATTCAGGCAGTTCTGGGCGAGATTACCGGTGCCAGAACGGTTC CCCGCGTCTTTATCGATGGCAAATTCATTGGCGGTGGCACTGACATCAAA CGAATGTTCGAGACAGGAGCTCTGCAAAAATATTTCCAATAAATAGTGTT CTTACTCTGTTCAGAACTCCGTTTTATGTAAAAAGTTTGTTAATCTTCAA AGTCCTTAATAAATGCTTTTAAAATTTAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 18859063..18859253 | 1..191 | 955 | 100 | Plus |
chr3L | 24539361 | chr3L | 18859483..18859664 | 296..477 | 895 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 18859312..18859420 | 190..298 | 545 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 18862556..18862746 | 1..191 | 955 | 100 | Plus |
3L | 28103327 | 3L | 18862976..18863158 | 296..478 | 915 | 100 | Plus |
3L | 28103327 | 3L | 18862805..18862913 | 190..298 | 545 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
FB | 1106 | FB DMTNFB 1106bp AKA(J01084) Derived from V00246 (g8708) (Rel. 36, Last updated, Version 3). | 441..520 | 341..418 | 125 | 65.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 18859484..18859664 | 297..477 | 99 | Plus | |
chr3L | 18859063..18859253 | 1..191 | 100 | -> | Plus |
chr3L | 18859314..18859418 | 192..296 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6852-RA | 1..345 | 48..392 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6852-RA | 1..345 | 48..392 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6852-RA | 1..345 | 48..392 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6852-RA | 1..345 | 48..392 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6852-RA | 1..345 | 48..392 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6852-RA | 1..477 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6852-RA | 1..477 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6852-RA | 119..595 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6852-RA | 1..477 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6852-RA | 119..595 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18869456..18869646 | 1..191 | 100 | -> | Plus |
3L | 18869707..18869811 | 192..296 | 100 | -> | Plus |
3L | 18869877..18870057 | 297..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18869456..18869646 | 1..191 | 100 | -> | Plus |
3L | 18869707..18869811 | 192..296 | 100 | -> | Plus |
3L | 18869877..18870057 | 297..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18869456..18869646 | 1..191 | 100 | -> | Plus |
3L | 18869707..18869811 | 192..296 | 100 | -> | Plus |
3L | 18869877..18870057 | 297..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 18862556..18862746 | 1..191 | 100 | -> | Plus |
arm_3L | 18862807..18862911 | 192..296 | 100 | -> | Plus |
arm_3L | 18862977..18863157 | 297..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18862556..18862746 | 1..191 | 100 | -> | Plus |
3L | 18862807..18862911 | 192..296 | 100 | -> | Plus |
3L | 18862977..18863157 | 297..477 | 100 | Plus |
Translation from 2 to 391
> GH24739.hyp ALPPKFPYPLLDFELMGAVGSALRSPIVDMSTKQAKFVENTIASNKVVIF SKTYCPYCTMAKEPFKKLNVDATIIELDGNPDGNEIQAVLGEITGARTVP RVFIDGKFIGGGTDIKRMFETGALQKYFQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6852-PC | 114 | CG6852-PC | 1..114 | 16..129 | 585 | 100 | Plus |
CG6852-PA | 114 | CG6852-PA | 1..114 | 16..129 | 585 | 100 | Plus |
Grx-1-PA | 116 | CG7975-PA | 1..116 | 16..129 | 415 | 68.1 | Plus |
Translation from 47 to 391
> GH24739.pep MGAVGSALRSPIVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPF KKLNVDATIIELDGNPDGNEIQAVLGEITGARTVPRVFIDGKFIGGGTDI KRMFETGALQKYFQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23644-PA | 100 | GF23644-PA | 1..100 | 15..114 | 507 | 93 | Plus |
Dana\GF13268-PA | 116 | GF13268-PA | 1..116 | 1..114 | 410 | 65.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16009-PA | 114 | GG16009-PA | 1..114 | 1..114 | 592 | 98.2 | Plus |
Dere\GG22140-PA | 116 | GG22140-PA | 1..116 | 1..114 | 436 | 69 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14597-PA | 100 | GH14597-PA | 1..100 | 15..114 | 407 | 72 | Plus |
Dgri\GH21128-PA | 116 | GH21128-PA | 1..116 | 1..114 | 400 | 63.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Grx1-PC | 114 | CG6852-PC | 1..114 | 1..114 | 585 | 100 | Plus |
Grx1-PA | 114 | CG6852-PA | 1..114 | 1..114 | 585 | 100 | Plus |
Grx1t-PA | 116 | CG7975-PA | 1..116 | 1..114 | 415 | 68.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18731-PA | 116 | GI18731-PA | 1..116 | 1..114 | 419 | 64.7 | Plus |
Dmoj\GI13483-PA | 100 | GI13483-PA | 1..100 | 15..114 | 414 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24885-PA | 100 | GL24885-PA | 1..99 | 15..113 | 458 | 84.8 | Plus |
Dper\GL16951-PA | 116 | GL16951-PA | 1..116 | 1..114 | 435 | 69 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19906-PA | 114 | GA19906-PA | 1..113 | 1..113 | 509 | 81.4 | Plus |
Dpse\GA20735-PA | 116 | GA20735-PA | 1..116 | 1..114 | 435 | 69 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14998-PA | 100 | GM14998-PA | 1..100 | 15..114 | 520 | 99 | Plus |
Dsec\GM15863-PA | 116 | GM15863-PA | 1..115 | 1..113 | 431 | 67.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14776-PA | 114 | GD14776-PA | 1..114 | 1..114 | 598 | 100 | Plus |
Dsim\GD11625-PA | 116 | GD11625-PA | 1..115 | 1..113 | 431 | 67.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21751-PA | 116 | GJ21751-PA | 1..116 | 1..114 | 430 | 67.2 | Plus |
Dvir\GJ11844-PA | 100 | GJ11844-PA | 1..100 | 15..114 | 421 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20447-PA | 111 | GK20447-PA | 1..111 | 1..114 | 452 | 72.8 | Plus |
Dwil\GK15655-PA | 116 | GK15655-PA | 1..116 | 1..114 | 410 | 68.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23086-PA | 114 | GE23086-PA | 1..114 | 1..114 | 598 | 100 | Plus |
Dyak\GE19570-PA | 100 | GE19570-PA | 1..100 | 15..114 | 526 | 100 | Plus |
Dyak\GE12221-PA | 116 | GE12221-PA | 1..116 | 1..114 | 436 | 69 | Plus |