Clone GH24739 Report

Search the DGRC for GH24739

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:247
Well:39
Vector:pOT2
Associated Gene/TranscriptCG6852-RA
Protein status:GH24739.pep: gold
Preliminary Size:478
Sequenced Size:496

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6852 2002-01-01 Sim4 clustering to Release 2
CG6852 2002-05-18 Blastp of sequenced clone
CG6852 2003-01-01 Sim4 clustering to Release 3
CG6852 2008-04-29 Release 5.5 accounting
CG6852 2008-08-15 Release 5.9 accounting
CG6852 2008-12-18 5.12 accounting

Clone Sequence Records

GH24739.complete Sequence

496 bp (496 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118819

> GH24739.complete
CCGCATTGCCCCCCAAGTTTCCGTACCCCCTCCTGGATTTCGAGCTTATG
GGTGCAGTTGGATCCGCTTTGAGATCCCCAATAGTCGACATGTCCACCAA
GCAGGCGAAATTCGTTGAAAACACCATTGCCAGCAACAAAGTGGTGATAT
TCAGCAAGACCTACTGTCCCTACTGCACGATGGCCAAAGAGCCCTTCAAA
AAGCTCAATGTGGACGCCACCATAATAGAACTCGATGGAAATCCCGATGG
CAACGAAATTCAGGCAGTTCTGGGCGAGATTACCGGTGCCAGAACGGTTC
CCCGCGTCTTTATCGATGGCAAATTCATTGGCGGTGGCACTGACATCAAA
CGAATGTTCGAGACAGGAGCTCTGCAAAAATATTTCCAATAAATAGTGTT
CTTACTCTGTTCAGAACTCCGTTTTATGTAAAAAGTTTGTTAATCTTCAA
AGTCCTTAATAAATGCTTTTAAAATTTAAAAAAAAAAAAAAAAAAA

GH24739.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6852-RA 704 CG6852-RA 227..704 1..478 2390 100 Plus
CG6852-RB 656 CG6852-RB 368..656 190..478 1445 100 Plus
CG6852-RB 656 CG6852-RB 119..309 1..191 955 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18859063..18859253 1..191 955 100 Plus
chr3L 24539361 chr3L 18859483..18859664 296..477 895 99.5 Plus
chr3L 24539361 chr3L 18859312..18859420 190..298 545 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:06:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18869456..18869646 1..191 955 100 Plus
3L 28110227 3L 18869876..18870058 296..478 915 100 Plus
3L 28110227 3L 18869705..18869813 190..298 545 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18862556..18862746 1..191 955 100 Plus
3L 28103327 3L 18862976..18863158 296..478 915 100 Plus
3L 28103327 3L 18862805..18862913 190..298 545 100 Plus
Blast to na_te.dros performed 2019-03-15 22:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
FB 1106 FB DMTNFB 1106bp AKA(J01084) Derived from V00246 (g8708) (Rel. 36, Last updated, Version 3). 441..520 341..418 125 65.4 Plus

GH24739.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:03:08 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18859484..18859664 297..477 99   Plus
chr3L 18859063..18859253 1..191 100 -> Plus
chr3L 18859314..18859418 192..296 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:55:26 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
CG6852-RA 1..345 48..392 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:45:51 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
CG6852-RA 1..345 48..392 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:06:59 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
CG6852-RA 1..345 48..392 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:10 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
CG6852-RA 1..345 48..392 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:10:38 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
CG6852-RA 1..345 48..392 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:21:21 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
CG6852-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:45:51 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
CG6852-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:06:59 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
CG6852-RA 119..595 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:10 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
CG6852-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:10:38 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
CG6852-RA 119..595 1..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:03:08 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18869456..18869646 1..191 100 -> Plus
3L 18869707..18869811 192..296 100 -> Plus
3L 18869877..18870057 297..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:03:08 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18869456..18869646 1..191 100 -> Plus
3L 18869707..18869811 192..296 100 -> Plus
3L 18869877..18870057 297..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:03:08 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18869456..18869646 1..191 100 -> Plus
3L 18869707..18869811 192..296 100 -> Plus
3L 18869877..18870057 297..477 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:06:59 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18862556..18862746 1..191 100 -> Plus
arm_3L 18862807..18862911 192..296 100 -> Plus
arm_3L 18862977..18863157 297..477 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:29 Download gff for GH24739.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18862556..18862746 1..191 100 -> Plus
3L 18862807..18862911 192..296 100 -> Plus
3L 18862977..18863157 297..477 100   Plus

GH24739.hyp Sequence

Translation from 2 to 391

> GH24739.hyp
ALPPKFPYPLLDFELMGAVGSALRSPIVDMSTKQAKFVENTIASNKVVIF
SKTYCPYCTMAKEPFKKLNVDATIIELDGNPDGNEIQAVLGEITGARTVP
RVFIDGKFIGGGTDIKRMFETGALQKYFQ*

GH24739.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG6852-PC 114 CG6852-PC 1..114 16..129 585 100 Plus
CG6852-PA 114 CG6852-PA 1..114 16..129 585 100 Plus
Grx-1-PA 116 CG7975-PA 1..116 16..129 415 68.1 Plus

GH24739.pep Sequence

Translation from 47 to 391

> GH24739.pep
MGAVGSALRSPIVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPF
KKLNVDATIIELDGNPDGNEIQAVLGEITGARTVPRVFIDGKFIGGGTDI
KRMFETGALQKYFQ*

GH24739.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23644-PA 100 GF23644-PA 1..100 15..114 507 93 Plus
Dana\GF13268-PA 116 GF13268-PA 1..116 1..114 410 65.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16009-PA 114 GG16009-PA 1..114 1..114 592 98.2 Plus
Dere\GG22140-PA 116 GG22140-PA 1..116 1..114 436 69 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14597-PA 100 GH14597-PA 1..100 15..114 407 72 Plus
Dgri\GH21128-PA 116 GH21128-PA 1..116 1..114 400 63.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Grx1-PC 114 CG6852-PC 1..114 1..114 585 100 Plus
Grx1-PA 114 CG6852-PA 1..114 1..114 585 100 Plus
Grx1t-PA 116 CG7975-PA 1..116 1..114 415 68.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18731-PA 116 GI18731-PA 1..116 1..114 419 64.7 Plus
Dmoj\GI13483-PA 100 GI13483-PA 1..100 15..114 414 75 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24885-PA 100 GL24885-PA 1..99 15..113 458 84.8 Plus
Dper\GL16951-PA 116 GL16951-PA 1..116 1..114 435 69 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19906-PA 114 GA19906-PA 1..113 1..113 509 81.4 Plus
Dpse\GA20735-PA 116 GA20735-PA 1..116 1..114 435 69 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14998-PA 100 GM14998-PA 1..100 15..114 520 99 Plus
Dsec\GM15863-PA 116 GM15863-PA 1..115 1..113 431 67.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14776-PA 114 GD14776-PA 1..114 1..114 598 100 Plus
Dsim\GD11625-PA 116 GD11625-PA 1..115 1..113 431 67.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21751-PA 116 GJ21751-PA 1..116 1..114 430 67.2 Plus
Dvir\GJ11844-PA 100 GJ11844-PA 1..100 15..114 421 75 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20447-PA 111 GK20447-PA 1..111 1..114 452 72.8 Plus
Dwil\GK15655-PA 116 GK15655-PA 1..116 1..114 410 68.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23086-PA 114 GE23086-PA 1..114 1..114 598 100 Plus
Dyak\GE19570-PA 100 GE19570-PA 1..100 15..114 526 100 Plus
Dyak\GE12221-PA 116 GE12221-PA 1..116 1..114 436 69 Plus