Clone GH24871 Report

Search the DGRC for GH24871

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:248
Well:71
Vector:pOT2
Associated Gene/TranscriptCG10750-RA
Protein status:GH24871.pep: gold
Preliminary Size:1299
Sequenced Size:1142

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10750 2001-01-01 Release 2 assignment
CG10750 2003-01-01 Sim4 clustering to Release 3
CG10750 2003-01-15 Blastp of sequenced clone
CG10750 2008-04-29 Release 5.5 accounting
CG10750 2008-08-15 Release 5.9 accounting
CG10750 2008-12-18 5.12 accounting

Clone Sequence Records

GH24871.complete Sequence

1142 bp (1142 high quality bases) assembled on 2003-01-15

GenBank Submission: AY069193

> GH24871.complete
TTCTCCAATAGATATTCCCCCAATATATATCAATATATTTGAAAAGATTA
TATTTTAATAGGACAAGATGCCGCGACGTAAGCCCACCATTAAGACCGAT
GTGATCGGGGATCTGGACCTCAGTCCAGAGGTCGCCATCGATGACTATCG
CGTCTCTCGCCAGCAGGACCAATTCTTCGTGAAACCGCCCAATTGGGATT
CGGCCGGGGATAACATCGAGATGCTGTACATAGCCAATCTCCGGGAGTAC
GACGCCATGAAGCAGGTTCAGATCCAGCTACTCAAAGATGCCAAGCGGCA
AGCCGCATTAAATGTGCAGCGCATTCGCAAGATGTACAAGATTCAGGAGC
GCCTGCGCAAACGCTTCGTCGAGGTGAATGGATTCATCAAGGATTGTGCG
GACAAAAAGCGCAGTGCGGATAAGTCGATTCGCGAGGAGACCGTTCTCCA
CGCGGAGGTCACCAAGGAGATAGACGAGTTCAAGACCTCCATTGCCGAAC
TGAGCACCTTTCGCAATGCGCTCAAGGCCACGGTGGCTCAGTTTCAGCCA
TACGAGAGGGTCCTGGAGGAGGTAGTCGAGGTGTCGGACATCTTCATCTC
AACGAAAGACTGCATCGATCGATGTGACGCTCTAATGTTGGCCCAGGTGG
AGATCAATAAGCTGGAGAGCCAGAAACTCAACGAGATCGAGGAGATGCGC
CTGCGAATGGTTCAGATCACCAGCGAGGCGGCCTTGACCGTTTTGGGCCT
CAAAAACGATCTGGCCCGTTTGGATCGTTCCTATGTCAGCTCGCGGGCCA
CTTGCCTCAAGTGGGAAAAGATACTAAGTGCCTGCAAGGACACCACGTCG
CTCTACAACCTGGACAAGGAGCGCATGTTTGATGGCATTCAAATCCTGTA
CCGCATGCTCTGCAAACGTCGAGACATTGTTCCCAGCTACCACAGCTATG
AGATCGACAAAATCATGAGCTTCATCATGCGCGAAATAAGTCTTCTTTCA
TCGGTCCTCCAGGAATTGGAGTCCAATAAGGGCGATAAAGTCGGCGCTGG
ACGTATGTGCTAGTCGGAAAATATAATATTTTTCATGGAGCATAAATAAA
TAAATAAATGATTTTAAATCCTTTAAAAAAAAAAAAAAAAAA

GH24871.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG10750-RA 1194 CG10750-RA 52..1177 1..1126 5630 100 Plus
CG17564-RB 1315 CG17564-RB 618..905 479..766 360 75 Plus
CG17564-RB 1315 CG17564-RB 471..548 332..409 195 83.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19299141..19299595 181..635 2275 100 Plus
chr2L 23010047 chr2L 19299651..19299938 636..923 1440 100 Plus
chr2L 23010047 chr2L 19299991..19300193 922..1124 985 99 Plus
chr2L 23010047 chr2L 19298899..19299079 1..181 905 100 Plus
chr2L 23010047 chr2L 19297589..19297884 627..332 205 71.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:06:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19300548..19301002 181..635 2275 100 Plus
2L 23513712 2L 19301058..19301345 636..923 1440 100 Plus
2L 23513712 2L 19301398..19301602 922..1126 1025 100 Plus
2L 23513712 2L 19300306..19300486 1..181 905 100 Plus
2L 23513712 2L 19298996..19299291 627..332 220 71.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19300548..19301002 181..635 2275 100 Plus
2L 23513712 2L 19301058..19301345 636..923 1440 100 Plus
2L 23513712 2L 19301398..19301602 922..1126 1025 100 Plus
2L 23513712 2L 19300306..19300486 1..181 905 100 Plus
2L 23513712 2L 19299214..19299291 409..332 195 83.3 Minus
2L 23513712 2L 19298996..19299144 627..479 190 75.1 Minus
2L 23513712 2L 19298799..19298926 766..639 175 75.7 Minus
Blast to na_te.dros performed 2019-03-16 10:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 1164..1211 1070..1117 132 75 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1048..1096 1118..1070 128 73.5 Minus
gypsy6 7826 gypsy6 GYPSY6 7826bp 5736..5783 1115..1068 114 70.8 Minus
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 4115..4171 1054..1113 112 70 Plus
Juan 4236 Juan JUAN 4236bp 4189..4234 1067..1111 110 73.9 Plus

GH24871.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:06:43 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19299651..19299938 636..923 100 -> Plus
chr2L 19299993..19300193 924..1124 99   Plus
chr2L 19298899..19299078 1..180 100 -> Plus
chr2L 19299141..19299595 181..635 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:55:31 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
CG10750-RA 1..996 68..1063 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:00 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
CG10750-RA 1..996 68..1063 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:55:49 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
CG10750-RA 1..996 68..1063 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:57 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
CG10750-RA 1..996 68..1063 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:55:21 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
CG10750-RA 1..996 68..1063 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:11:33 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
CG10750-RA 1..1124 1..1124 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:00 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
CG10750-RA 1..1124 1..1124 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:55:49 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
CG10750-RA 52..1175 1..1124 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:57 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
CG10750-RA 1..1124 1..1124 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:55:21 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
CG10750-RA 52..1175 1..1124 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:43 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19300306..19300485 1..180 100 -> Plus
2L 19300548..19301002 181..635 100 -> Plus
2L 19301058..19301345 636..923 100 -> Plus
2L 19301400..19301600 924..1124 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:43 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19300306..19300485 1..180 100 -> Plus
2L 19300548..19301002 181..635 100 -> Plus
2L 19301058..19301345 636..923 100 -> Plus
2L 19301400..19301600 924..1124 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:43 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19300306..19300485 1..180 100 -> Plus
2L 19300548..19301002 181..635 100 -> Plus
2L 19301058..19301345 636..923 100 -> Plus
2L 19301400..19301600 924..1124 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:55:49 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19300306..19300485 1..180 100 -> Plus
arm_2L 19300548..19301002 181..635 100 -> Plus
arm_2L 19301058..19301345 636..923 100 -> Plus
arm_2L 19301400..19301600 924..1124 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:09 Download gff for GH24871.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19300548..19301002 181..635 100 -> Plus
2L 19301058..19301345 636..923 100 -> Plus
2L 19301400..19301600 924..1124 100   Plus
2L 19300306..19300485 1..180 100 -> Plus

GH24871.pep Sequence

Translation from 67 to 1062

> GH24871.pep
MPRRKPTIKTDVIGDLDLSPEVAIDDYRVSRQQDQFFVKPPNWDSAGDNI
EMLYIANLREYDAMKQVQIQLLKDAKRQAALNVQRIRKMYKIQERLRKRF
VEVNGFIKDCADKKRSADKSIREETVLHAEVTKEIDEFKTSIAELSTFRN
ALKATVAQFQPYERVLEEVVEVSDIFISTKDCIDRCDALMLAQVEINKLE
SQKLNEIEEMRLRMVQITSEAALTVLGLKNDLARLDRSYVSSRATCLKWE
KILSACKDTTSLYNLDKERMFDGIQILYRMLCKRRDIVPSYHSYEIDKIM
SFIMREISLLSSVLQELESNKGDKVGAGRMC*

GH24871.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:34:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14711-PA 331 GF14711-PA 1..331 1..331 1486 83.4 Plus
Dana\GF15201-PA 332 GF15201-PA 1..331 1..329 995 56.8 Plus
Dana\GF15202-PA 335 GF15202-PA 1..320 1..320 934 55.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21168-PA 331 GG21168-PA 1..331 1..331 1688 96.1 Plus
Dere\GG21640-PA 335 GG21640-PA 1..320 1..320 1022 60.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13442-PA 337 GH13442-PA 1..325 1..326 1159 68.1 Plus
Dgri\GH13474-PA 333 GH13474-PA 1..303 1..299 950 58.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG10750-PA 331 CG10750-PA 1..331 1..331 1665 100 Plus
CG10750-PB 331 CG10750-PB 1..331 1..331 1658 99.7 Plus
CG17564-PB 335 CG17564-PB 1..320 1..320 993 60.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14005-PA 336 GI14005-PA 1..335 1..331 1154 66.9 Plus
Dmoj\GI17227-PA 328 GI17227-PA 1..322 1..324 987 58 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21195-PA 329 GL21195-PA 1..329 1..331 1106 63.1 Plus
Dper\GL21116-PA 334 GL21116-PA 1..334 1..331 1090 60.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10542-PA 329 GA10542-PA 1..329 1..331 1108 63.1 Plus
Dpse\GA14557-PA 334 GA14557-PA 1..334 1..331 1087 60.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17333-PA 331 GM17333-PA 1..331 1..331 1716 97.9 Plus
Dsec\GM17018-PA 335 GM17018-PA 1..320 1..320 1027 60.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24193-PA 297 GD24193-PA 1..297 1..331 1491 87.3 Plus
Dsim\GD21768-PA 335 GD21768-PA 1..320 1..320 1027 60.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18249-PA 336 GJ18249-PA 1..335 1..331 1188 68.1 Plus
Dvir\GJ17986-PA 333 GJ17986-PA 1..324 1..323 969 55.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23826-PA 336 GK23826-PA 1..324 1..324 1198 68.8 Plus
Dwil\GK23847-PA 338 GK23847-PA 1..315 1..315 1050 61.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13241-PA 331 GE13241-PA 1..331 1..331 1680 95.8 Plus
Dyak\GE12659-PA 335 GE12659-PA 1..320 1..320 1015 60.3 Plus

GH24871.hyp Sequence

Translation from 67 to 1062

> GH24871.hyp
MPRRKPTIKTDVIGDLDLSPEVAIDDYRVSRQQDQFFVKPPNWDSAGDNI
EMLYIANLREYDAMKQVQIQLLKDAKRQAALNVQRIRKMYKIQERLRKRF
VEVNGFIKDCADKKRSADKSIREETVLHAEVTKEIDEFKTSIAELSTFRN
ALKATVAQFQPYERVLEEVVEVSDIFISTKDCIDRCDALMLAQVEINKLE
SQKLNEIEEMRLRMVQITSEAALTVLGLKNDLARLDRSYVSSRATCLKWE
KILSACKDTTSLYNLDKERMFDGIQILYRMLCKRRDIVPSYHSYEIDKIM
SFIMREISLLSSVLQELESNKGDKVGAGRMC*

GH24871.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG10750-PA 331 CG10750-PA 1..331 1..331 1665 100 Plus
CG10750-PB 331 CG10750-PB 1..331 1..331 1658 99.7 Plus
CG17564-PB 335 CG17564-PB 1..320 1..320 993 60.9 Plus