Clone GH25158 Report

Search the DGRC for GH25158

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:251
Well:58
Vector:pOT2
Associated Gene/TranscriptCG5399-RA
Protein status:GH25158.pep: gold
Sequenced Size:1017

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5399 2003-01-01 Sim4 clustering to Release 3
CG5399 2008-04-29 Release 5.5 accounting
CG5399 2008-08-15 Release 5.9 accounting
CG5399 2008-12-18 5.12 accounting

Clone Sequence Records

GH25158.complete Sequence

1017 bp (1017 high quality bases) assembled on 2005-05-20

GenBank Submission: BT023404

> GH25158.complete
CAGCGAACCGATCGCAGAACCGGAACCTTAAAGCGGAAGATATAGAACTC
ATATAGACAGTGACATCATGTGCAATAGTGCGATCATCTGCCTGGCAATC
GTGGCCGCCGTGGCCTCCATCTCTCAGGTTTCGGCCCAAGCCCAAACAAC
GCCACAATCCTGCGCCCAAGCCACCGGCATTAGTTTTAACCAGACCGCTT
TTAGTGGTCAGTGGGTCGAGTTGGCCCGCAATCCCGCCTCAAATGTCTCC
TGCATTTCCCTTAACGTGGCTTTCTGGAACAACAACAATTACATGCTGGT
CAATGTCAGCCATTCAAGCAATGTCGCCTCCACTTTGGTGGACGTCTATG
AAACTGCGAATATCACGCTGGTGGAGAACAACCTCAGCGGATACAATGTC
ACCCTGGTGAATGGCCAGAAGCAGGAGTACGTCTTCGTGAAGTTGCTTAG
CTTTGTGAACTCCACCTATCTGGTTGGATGCACCTACACCAATGCTACCA
ACACATCAACCAGTGCTGGTTTTATTCTGGGTAGGTCCACCTATACTCCG
GAAGGCGTAAGGATTGCCAACAATGATGCCTCCGTGTCCTTCAGCAATTT
CCAGAACAACACCTACGGCAATGTCACTCAGTTGGATTGCCGTGCCAGTT
CCGCCGGACAGACTGTGCCTCTGACCCTGATATCTGGCTTCCTTGCCTTT
GCCCTTTTGCTGATCAAGGCCTAAAAATGGAGATGTATCCAATGGCTGCT
TTGCCTAGCCACCATAAATGAAAAAAAAAAAACTAACAAAATCCAATCAC
TTGCCTAAGTTATTGTGTCATACTCTTTATTTAGTTTTTAGTTGACTTTA
AACACCGCACTCTGAAATCGAGGCAAGGCAAAATGATGTCAATAAAAGTA
AACCGAAATGGGTGAGGGCCCATAAAAAGCCCCCACTGAAAAGAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

GH25158.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG5399-RA 1411 CG5399-RA 160..1104 1..945 4725 100 Plus
CG5399.c 1574 CG5399.c 144..1088 1..945 4725 100 Plus
CG5399.b 1284 CG5399.b 144..1088 1..945 4725 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11520370..11520806 200..636 2170 99.8 Plus
chr3R 27901430 chr3R 11520880..11521186 637..943 1535 100 Plus
chr3R 27901430 chr3R 11519888..11520093 1..206 1000 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:06:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15695749..15696185 200..636 2185 100 Plus
3R 32079331 3R 15696259..15696567 637..945 1545 100 Plus
3R 32079331 3R 15695267..15695472 1..206 1000 99 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15436580..15437016 200..636 2185 100 Plus
3R 31820162 3R 15437090..15437398 637..945 1545 100 Plus
3R 31820162 3R 15436098..15436303 1..206 1000 99 Plus
Blast to na_te.dros performed on 2019-03-16 07:51:50 has no hits.

GH25158.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:52:54 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11520880..11521186 637..943 100   Plus
chr3R 11519888..11520086 1..199 100 -> Plus
chr3R 11520370..11520806 200..636 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:55:43 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
CG5399-RA 1..657 68..724 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:01:50 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
CG5399-RA 1..657 68..724 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:49:04 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
CG5399-RA 1..657 68..724 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:42:21 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
CG5399-RA 1..657 68..724 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:42:16 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
CG5399-RA 1..657 68..724 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:45:55 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
CG5399-RA 1..939 4..942 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:01:50 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
CG5399-RA 1..939 4..942 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:49:04 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
CG5399-RA 27..969 1..943 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:42:21 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
CG5399-RA 1..939 4..942 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:42:16 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
CG5399-RA 27..969 1..943 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:54 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15695267..15695465 1..199 100 -> Plus
3R 15695749..15696185 200..636 100 -> Plus
3R 15696259..15696565 637..943 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:54 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15695267..15695465 1..199 100 -> Plus
3R 15695749..15696185 200..636 100 -> Plus
3R 15696259..15696565 637..943 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:54 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15695267..15695465 1..199 100 -> Plus
3R 15695749..15696185 200..636 100 -> Plus
3R 15696259..15696565 637..943 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:49:04 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11520989..11521187 1..199 100 -> Plus
arm_3R 11521471..11521907 200..636 100 -> Plus
arm_3R 11521981..11522287 637..943 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:21:23 Download gff for GH25158.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15436580..15437016 200..636 100 -> Plus
3R 15437090..15437396 637..943 100   Plus
3R 15436098..15436296 1..199 100 -> Plus

GH25158.pep Sequence

Translation from 67 to 723

> GH25158.pep
MCNSAIICLAIVAAVASISQVSAQAQTTPQSCAQATGISFNQTAFSGQWV
ELARNPASNVSCISLNVAFWNNNNYMLVNVSHSSNVASTLVDVYETANIT
LVENNLSGYNVTLVNGQKQEYVFVKLLSFVNSTYLVGCTYTNATNTSTSA
GFILGRSTYTPEGVRIANNDASVSFSNFQNNTYGNVTQLDCRASSAGQTV
PLTLISGFLAFALLLIKA*

GH25158.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18532-PA 209 GF18532-PA 1..209 1..218 500 49.5 Plus
Dana\GF18531-PA 230 GF18531-PA 14..229 11..210 169 30.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16940-PA 213 GG16940-PA 1..213 1..218 875 83 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18210-PA 238 GH18210-PA 44..237 29..218 284 42.3 Plus
Dgri\GH18209-PA 247 GH18209-PA 55..244 31..215 156 28.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5399-PB 218 CG5399-PB 1..218 1..218 1100 100 Plus
CG5399-PA 218 CG5399-PA 1..218 1..218 1100 100 Plus
CG31446-PA 232 CG31446-PA 8..223 5..215 161 30.9 Plus
CG31446-PB 237 CG31446-PB 8..228 5..215 157 30.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10163-PA 218 GI10163-PA 17..217 22..218 408 45.8 Plus
Dmoj\GI10162-PA 231 GI10162-PA 34..228 27..218 151 28.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12697-PA 224 GL12697-PA 1..221 1..216 535 56.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18852-PA 224 GA18852-PA 1..221 1..216 533 55.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24248-PA 212 GM24248-PA 1..212 1..218 971 89.4 Plus
Dsec\GM24247-PA 232 GM24247-PA 8..223 5..215 141 31.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19037-PA 214 GD19037-PA 1..214 1..218 973 90.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10865-PA 218 GJ10865-PA 8..217 11..218 379 48.1 Plus
Dvir\GJ10864-PA 231 GJ10864-PA 34..229 27..216 159 28.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11408-PA 222 GK11408-PA 26..219 31..216 304 42 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24327-PA 214 GE24327-PA 1..214 1..218 930 85.8 Plus

GH25158.hyp Sequence

Translation from 67 to 723

> GH25158.hyp
MCNSAIICLAIVAAVASISQVSAQAQTTPQSCAQATGISFNQTAFSGQWV
ELARNPASNVSCISLNVAFWNNNNYMLVNVSHSSNVASTLVDVYETANIT
LVENNLSGYNVTLVNGQKQEYVFVKLLSFVNSTYLVGCTYTNATNTSTSA
GFILGRSTYTPEGVRIANNDASVSFSNFQNNTYGNVTQLDCRASSAGQTV
PLTLISGFLAFALLLIKA*

GH25158.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG5399-PB 218 CG5399-PB 1..218 1..218 1100 100 Plus
CG5399-PA 218 CG5399-PA 1..218 1..218 1100 100 Plus
CG31446-PA 232 CG31446-PA 8..223 5..215 161 30.9 Plus
CG31446-PB 237 CG31446-PB 8..228 5..215 157 30.2 Plus