Clone GH25284 Report

Search the DGRC for GH25284

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:252
Well:84
Vector:pOT2
Associated Gene/Transcriptscpr-B-RA
Protein status:GH25284.pep: gold
Preliminary Size:1044
Sequenced Size:919

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17210 2001-01-01 Release 2 assignment
CG17210 2001-10-10 Blastp of sequenced clone
CG17210 2003-01-01 Sim4 clustering to Release 3
scpr-B 2008-04-29 Release 5.5 accounting
scpr-B 2008-08-15 Release 5.9 accounting
scpr-B 2008-12-18 5.12 accounting

Clone Sequence Records

GH25284.complete Sequence

919 bp (919 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060783

> GH25284.complete
AAGATGGCCATTAAGTGTCTGATTTTGCTTACTTCCCTGCTGGGAATAAG
CCTTGCAGCGGACTATTGTGCTCTGCCCACGTGCCTGGACAAGCACATAG
CCTGCAACAACAAGGGAAATTTCAGTGAAAATTGTCCCAAGGACGTGCGT
GAGGTGAAGATCGAGCCGCATCACAAACTCATCCTCAATCTCTTCAACGA
GCTGCGCAACAACGTGGCTGGAGGCAAAATAGAAGGACTACCCAAGGCTG
TTCGCATGGCCAAGATGTCCTGGTGCGAGGAGCTCTCCCATCTGGCCTTG
CTGAACGTAAAGACCTGTGAGTCCCTGCCAGATAAATGTCGCAGCACCGA
GAGATTCGCCTACGCCGGCCAGAACAACGCCTTGTTCCAGTACAGCGGAG
CCGAGACAGAGTACACCGATGCGGAAATAATAAAGGAGCAGATCGAGAAC
TGGTTTGCTGAGCGCTCGAATGCATCTCCCGAGATCCTCGCCAGCTTCCC
GGAGGAGCTTCCCAACAAGGCGGTGACCAAGTTCACCATCGCGGTGGCCG
AGAAGAACACCCATGTGGGATGTGCGGCCGTGCGCTTCTCCCGGGACTTT
TACAACCACTTCGTACTCACCTGCAACTTCGCCACATCGAACATTGTGGG
TCAGCCTGTCTACACTCCGGGAGAGAAGGCAACCACCGGCTGCAAGAACC
GATATGGAGCTGCCTACGACTACCCCAATCTGTGCTACGCCAAGGAGATC
TACGACAACGAGAAGGTCATCGAGAACACACAGACGATGTAGGTGATAGT
AGATGCTGGGATCTTAAACATGAACGCGGAACGGAAGCTTTATTAATATC
AATTCGGTATATATAATTAACATGCAACTGGCAATAATGAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

GH25284.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
scpr-B-RA 1092 scpr-B-RA 197..1087 1..891 4455 100 Plus
scpr-C-RA 1058 scpr-C-RA 103..895 1..793 3815 98.7 Plus
scpr-A-RA 879 scpr-A-RA 78..808 61..791 3370 97.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7065615..7066386 889..118 3800 99.5 Minus
chr3R 27901430 chr3R 7051295..7051970 118..793 3230 98.5 Plus
chr3R 27901430 chr3R 7066958..7067628 121..791 3160 98.1 Plus
chr3R 27901430 chr3R 7066440..7066556 117..1 585 100 Minus
chr3R 27901430 chr3R 7051125..7051241 1..117 570 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:07:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11240039..11240812 891..118 3870 100 Minus
3R 32079331 3R 11225703..11226378 118..793 3245 98.7 Plus
3R 32079331 3R 11241384..11242054 121..791 3190 98.4 Plus
3R 32079331 3R 11240866..11240982 117..1 585 100 Minus
3R 32079331 3R 11225533..11225649 1..117 570 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10980870..10981643 891..118 3870 100 Minus
3R 31820162 3R 10966534..10967209 118..793 3245 98.6 Plus
3R 31820162 3R 10982215..10982885 121..791 3190 98.3 Plus
3R 31820162 3R 10981697..10981813 117..1 585 100 Minus
3R 31820162 3R 10966364..10966480 1..117 570 99.1 Plus
3R 31820162 3R 10982090..10982146 61..117 180 87.7 Plus
Blast to na_te.dros performed on 2019-03-16 03:49:17 has no hits.

GH25284.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:50:17 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7065615..7066386 118..889 99 <- Minus
chr3R 7066440..7066556 1..117 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:55:51 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-B-RA 1..789 4..792 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:36:03 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-B-RA 1..789 4..792 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:44 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-B-RA 1..789 4..792 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:04:55 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-B-RA 1..789 4..792 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:15:51 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-B-RA 1..789 4..792 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:16:10 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-B-RA 10..898 1..889 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:36:03 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-B-RA 10..898 1..889 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:44 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-B-RA 10..898 1..889 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:04:55 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-B-RA 10..898 1..889 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:15:51 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-B-RA 10..898 1..889 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:17 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11240041..11240812 118..889 100 <- Minus
3R 11240866..11240982 1..117 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:17 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11240041..11240812 118..889 100 <- Minus
3R 11240866..11240982 1..117 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:17 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11240041..11240812 118..889 100 <- Minus
3R 11240866..11240982 1..117 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:44 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7065763..7066534 118..889 100 <- Minus
arm_3R 7066588..7066704 1..117 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:40:46 Download gff for GH25284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10980872..10981643 118..889 100 <- Minus
3R 10981697..10981813 1..117 100   Minus

GH25284.hyp Sequence

Translation from 0 to 791

> GH25284.hyp
KMAIKCLILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVR
EVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLAL
LNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEQIEN
WFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDF
YNHFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEI
YDNEKVIENTQTM*

GH25284.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
scpr-B-PA 262 CG17210-PA 1..262 2..263 1394 100 Plus
scpr-C-PB 262 CG5106-PB 1..262 2..263 1381 99.2 Plus
scpr-C-PA 262 CG5106-PA 1..262 2..263 1381 99.2 Plus
scpr-A-PA 264 CG5207-PA 9..264 8..263 1324 95.7 Plus
Ag5r2-PA 254 CG9540-PA 1..250 2..252 411 34.6 Plus

GH25284.pep Sequence

Translation from 3 to 791

> GH25284.pep
MAIKCLILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVRE
VKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALL
NVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEQIENW
FAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFY
NHFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIY
DNEKVIENTQTM*

GH25284.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18165-PA 262 GF18165-PA 1..256 1..256 1251 88.3 Plus
Dana\GF16741-PA 260 GF16741-PA 1..259 3..261 1223 83.4 Plus
Dana\GF18253-PA 268 GF18253-PA 12..267 6..261 1210 84.4 Plus
Dana\GF21598-PA 255 GF21598-PA 8..251 7..251 441 35.5 Plus
Dana\GF21595-PA 256 GF21595-PA 11..255 6..251 416 38 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17230-PA 262 GG17230-PA 1..262 1..262 1289 95 Plus
Dere\GG18056-PA 264 GG18056-PA 9..264 7..262 1285 91 Plus
Dere\GG17989-PA 262 GG17989-PA 1..262 1..262 1279 94.7 Plus
Dere\GG19450-PA 288 GG19450-PA 35..284 1..251 435 35 Plus
Dere\GG13982-PA 277 GG13982-PA 24..262 14..252 382 38.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17351-PA 260 GH17351-PA 1..258 3..260 1203 82.9 Plus
Dgri\GH18802-PA 260 GH18802-PA 1..254 3..256 1190 82.7 Plus
Dgri\GH14934-PA 265 GH14934-PA 6..263 3..260 1184 81.4 Plus
Dgri\GH17451-PA 253 GH17451-PA 4..252 6..251 429 36.9 Plus
Dgri\GH24697-PA 274 GH24697-PA 19..268 1..251 399 34.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
scpr-B-PA 262 CG17210-PA 1..262 1..262 1394 100 Plus
scpr-C-PB 262 CG5106-PB 1..262 1..262 1381 99.2 Plus
scpr-C-PA 262 CG5106-PA 1..262 1..262 1381 99.2 Plus
scpr-A-PA 264 CG5207-PA 9..264 7..262 1324 95.7 Plus
Ag5r2-PA 254 CG9540-PA 1..250 1..251 411 34.6 Plus
CG6628-PA 277 CG6628-PA 30..262 20..252 393 39.5 Plus
CG32679-PA 254 CG32679-PA 11..248 6..251 369 34.7 Plus
Ag5r-PC 256 CG9538-PC 10..250 9..251 368 33.3 Plus
Ag5r-PB 256 CG9538-PB 10..250 9..251 368 33.3 Plus
Ag5r-PA 256 CG9538-PA 10..250 9..251 368 33.3 Plus
CG17575-PA 291 CG17575-PA 9..287 6..255 362 34.9 Plus
CG9822-PA 263 CG9822-PA 9..257 3..251 361 33.9 Plus
CG31296-PB 280 CG31296-PB 18..261 14..260 357 33.5 Plus
CG31296-PA 280 CG31296-PA 18..261 14..260 357 33.5 Plus
CG17575-PB 298 CG17575-PB 9..294 6..255 347 34.5 Plus
CG3640-PA 296 CG3640-PA 10..251 5..251 336 33.5 Plus
CG42564-PA 500 CG10284-PA 54..284 20..251 328 34.9 Plus
CG17974-PA 259 CG17974-PA 7..256 5..251 323 32.9 Plus
CG42780-PA 253 CG42780-PA 8..250 7..244 316 32.1 Plus
CG9400-PA 308 CG9400-PA 69..302 31..262 316 31.5 Plus
CG42780-PB 254 CG42780-PB 8..251 7..244 307 32 Plus
CG34002-PB 350 CG34002-PB 11..251 9..244 260 30.7 Plus
CG10651-PB 316 CG10651-PB 2..252 3..249 245 29.2 Plus
CG10651-PA 316 CG10651-PA 2..252 3..249 245 29.2 Plus
CG30486-PA 263 CG30486-PA 17..250 16..248 219 27.6 Plus
CG8072-PA 247 CG8072-PA 20..247 17..251 206 28.9 Plus
CG43775-PA 272 CG43775-PA 70..262 61..244 184 31 Plus
CG43776-PA 270 CG43776-PA 67..260 60..245 158 27.8 Plus
CG43776-PB 270 CG43776-PB 67..260 60..245 158 27.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes33-PA 265 GI23699-PA 9..265 6..262 1205 82.5 Plus
Dmoj\GI23890-PA 260 GI23890-PA 1..260 3..262 1203 81.2 Plus
Dmoj\Tes104-PA 260 GI22692-PA 1..258 3..260 1200 81.8 Plus
Dmoj\GI15745-PA 257 GI15745-PA 8..250 7..251 424 38.3 Plus
Dmoj\GI15744-PA 256 GI15744-PA 17..255 14..251 418 37.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12032-PA 261 GL12032-PA 5..255 6..256 1177 86.1 Plus
Dper\GL12570-PA 261 GL12570-PA 5..255 6..256 1169 85.7 Plus
Dper\GL12692-PA 287 GL12692-PA 1..256 1..258 410 34.9 Plus
Dper\GL12693-PA 296 GL12693-PA 1..258 1..258 405 34.6 Plus
Dper\GL20410-PA 254 GL20410-PA 18..250 18..251 399 34.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18663-PA 261 GA18663-PA 5..255 6..256 1169 85.7 Plus
Dpse\GA29233-PA 258 GA29233-PA 6..257 7..251 465 39.2 Plus
Dpse\GA16157-PA 287 GA16157-PA 1..256 1..258 410 34.9 Plus
Dpse\GA27590-PA 296 GA27590-PA 1..258 1..258 405 34.6 Plus
Dpse\GA21866-PA 254 GA21866-PA 18..250 18..251 399 34.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26110-PA 262 GM26110-PA 1..262 1..262 1386 98.5 Plus
Dsec\GM23927-PA 262 GM23927-PA 1..262 1..262 1377 97.7 Plus
Dsec\GM16873-PA 224 GM16873-PA 1..224 39..262 1186 98.2 Plus
Dsec\GM23934-PA 221 GM23934-PA 8..221 49..262 1129 97.7 Plus
Dsec\GM26114-PA 449 GM26114-PA 9..192 7..190 945 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20669-PA 262 GD20669-PA 1..262 1..262 1380 97.7 Plus
Dsim\GD18744-PA 277 GD18744-PA 9..259 7..257 1281 92.4 Plus
Dsim\GD18740-PA 261 GD18740-PA 1..261 1..262 1238 94.3 Plus
Dsim\GD16039-PA 254 GD16039-PA 8..248 3..251 380 34.7 Plus
Dsim\GD12870-PA 277 GD12870-PA 30..262 20..252 373 37.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24678-PA 261 GJ24678-PA 2..261 3..262 1205 83.5 Plus
Dvir\GJ23982-PA 265 GJ23982-PA 9..265 6..262 1192 81.7 Plus
Dvir\GJ23256-PA 260 GJ23256-PA 12..260 14..262 1175 83.5 Plus
Dvir\GJ23420-PA 260 GJ23420-PA 18..260 20..262 1159 85.6 Plus
Dvir\GJ18605-PA 253 GJ18605-PA 2..252 3..251 439 37 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13988-PA 262 GK13988-PA 6..262 6..262 1184 82.1 Plus
Dwil\GK14308-PA 260 GK14308-PA 1..259 3..261 1177 80.3 Plus
Dwil\GK13291-PA 266 GK13291-PA 10..266 5..262 1157 80.6 Plus
Dwil\GK18435-PA 257 GK18435-PA 23..256 18..251 474 42.4 Plus
Dwil\GK14730-PA 256 GK14730-PA 17..255 15..251 449 41.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26087-PA 264 GE26087-PA 9..264 7..262 1294 91.8 Plus
Dyak\GE24631-PA 262 GE24631-PA 1..262 1..262 1289 94.7 Plus
Dyak\GE26080-PA 262 GE26080-PA 1..262 1..262 1280 93.5 Plus
Dyak\GE16103-PA 283 GE16103-PA 30..279 1..251 440 35.4 Plus
Dyak\GE15398-PA 253 GE15398-PA 11..247 7..251 373 34.4 Plus