Clone GH25305 Report

Search the DGRC for GH25305

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:253
Well:5
Vector:pOT2
Associated Gene/TranscriptUbc87F-RA
Protein status:GH25305.pep: gold
Sequenced Size:647

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9602 2002-11-11 Blastp of sequenced clone
CG9602 2003-01-01 Sim4 clustering to Release 3
CG9602 2008-04-29 Release 5.5 accounting
CG9602 2008-08-15 Release 5.9 accounting
CG9602 2008-12-18 5.12 accounting

Clone Sequence Records

GH25305.complete Sequence

647 bp (647 high quality bases) assembled on 2002-11-11

GenBank Submission: BT001441

> GH25305.complete
TGACTCGAAACAATTGAACAAAATTCCATCCAGTGACATGTCCGAACTGC
AAGCATCGCTACTGCTCAATCGCCAGCTCTCCGAATTACAACGCCATCCC
GTCGAGGGCTTCTCCGCCGGTCTGGTCAGCGACTCCGACATCTTCAAATG
GGAGGTGGTGATCATCGGTCCCCCAGATACGCTATACGAGGGCGGCTTCT
TCAAGGCTCACCTGATCTTCCCCAAAGAGTACCCACTGCGCCCGCCCAAG
ATGAAGTTCATCACCGAAATCTGGCATCCCAATATTGACAAGGCCGGCGA
CGTTTGCATCTCGATCCTCCACGAACCTGGTGACGATAAGTGGGGCTACG
AGAAGGCCGAGGAGCGCTGGCTACCGGTCCACACCGTGGAGACGATCCTT
CTTTCCGTTATCTCCATGCTCACCGATCCCAATGACGAGTCGGCCGCCAA
TGTGGATGCGGCCAAGGAGTACCGGGAGAATTATGCGGAATTCAAGCGCA
AGGTCACCAGGTGCGTCCGCCGTAGTCAGGAGGAGGTGGAATAGACCGGA
TAGACTGGGCAGTGACATGATGATCAGGAACGGCACACATGCTAATCACG
TGAATAAAGAGAGCAACTAGTGGAAAAAAAAAAAAAAAAAAAAAAAA

GH25305.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9602-RA 844 CG9602-RA 101..726 1..626 3130 100 Plus
CG40045-RA 1255 CG40045-RA 328..623 173..468 310 73.6 Plus
CG40045.g 1304 CG40045.g 328..623 173..468 310 73.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9542335..9542929 623..29 2975 100 Minus
chr3L 24539361 chr3L 24024339..24024620 187..468 270 73 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:07:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13717451..13718048 626..29 2990 100 Minus
3L 28110227 3L 24035432..24035713 187..468 270 73 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13458282..13458879 626..29 2990 100 Minus
3L 28103327 3L 24028532..24028813 187..468 270 73 Plus
3R 31820162 3R 13458943..13458970 28..1 140 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:16:41 has no hits.

GH25305.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:17:33 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9542335..9542929 29..623 100 <- Minus
chr3R 9542993..9543020 1..28 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:55:53 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
CG9602-RA 1..507 38..544 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:30:03 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
CG9602-RA 1..507 38..544 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:13:52 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
CG9602-RA 1..507 38..544 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:03:49 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
CG9602-RA 1..507 38..544 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:16:52 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc87F-RA 1..507 38..544 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:56:17 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
CG9602-RA 28..650 1..623 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:30:03 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
CG9602-RA 38..660 1..623 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:13:52 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
CG9602-RA 38..660 1..623 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:03:50 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
CG9602-RA 28..650 1..623 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:16:52 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc87F-RA 38..660 1..623 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:17:33 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13717454..13718048 29..623 100 <- Minus
3R 13718112..13718139 1..28 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:17:33 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13717454..13718048 29..623 100 <- Minus
3R 13718112..13718139 1..28 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:17:33 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13717454..13718048 29..623 100 <- Minus
3R 13718112..13718139 1..28 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:13:52 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9543176..9543770 29..623 100 <- Minus
arm_3R 9543834..9543861 1..28 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:37:28 Download gff for GH25305.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13458285..13458879 29..623 100 <- Minus
3R 13458943..13458970 1..28 100   Minus

GH25305.hyp Sequence

Translation from 0 to 543

> GH25305.hyp
DSKQLNKIPSSDMSELQASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKW
EVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKFITEIWHPNIDKAGD
VCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAAN
VDAAKEYRENYAEFKRKVTRCVRRSQEEVE*

GH25305.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc87F-PA 168 CG9602-PA 1..168 13..180 890 100 Plus
CG40045-PA 168 CG40045-PA 1..166 13..178 772 83.1 Plus
CG40045-PD 167 CG40045-PD 1..165 13..178 753 82.5 Plus
CG40045-PC 132 CG40045-PC 15..130 63..178 567 87.1 Plus
CG40045-PB 97 CG40045-PB 1..95 84..178 456 86.3 Plus

GH25305.pep Sequence

Translation from 37 to 543

> GH25305.pep
MSELQASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLY
EGGFFKAHLIFPKEYPLRPPKMKFITEIWHPNIDKAGDVCISILHEPGDD
KWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAANVDAAKEYRENYA
EFKRKVTRCVRRSQEEVE*

GH25305.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18145-PA 167 GF18145-PA 1..167 1..167 848 94.6 Plus
Dana\GF19999-PA 113 GF19999-PA 1..112 56..167 529 85.7 Plus
Dana\GF21159-PA 167 GF21159-PA 9..162 10..163 444 54.5 Plus
Dana\GF21720-PA 311 GF21720-PA 4..148 2..146 396 51 Plus
Dana\GF16080-PA 151 GF16080-PA 9..148 10..163 298 39 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17023-PA 168 GG17023-PA 1..168 1..168 874 97.6 Plus
Dere\GG16305-PA 168 GG16305-PA 1..167 1..167 771 82.6 Plus
Dere\GG19056-PA 167 GG19056-PA 9..162 10..163 445 54.5 Plus
Dere\GG11277-PA 151 GG11277-PA 9..148 10..163 298 39 Plus
Dere\GG21088-PA 147 GG21088-PA 6..143 10..158 295 39.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14044-PA 167 GH14044-PA 1..167 1..167 796 88 Plus
Dgri\GH22344-PA 170 GH22344-PA 16..169 14..167 720 83.1 Plus
Dgri\GH24823-PA 167 GH24823-PA 9..162 10..163 457 55.2 Plus
Dgri\GH14479-PA 324 GH14479-PA 46..182 10..146 427 55.5 Plus
Dgri\GH15302-PA 151 GH15302-PA 9..148 10..163 298 39 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc87F-PA 168 CG9602-PA 1..168 1..168 890 100 Plus
CG40045-PA 168 CG40045-PA 1..166 1..166 772 83.1 Plus
CG40045-PD 167 CG40045-PD 1..165 1..166 753 82.5 Plus
CG40045-PC 132 CG40045-PC 15..130 51..166 567 87.1 Plus
CG40045-PB 97 CG40045-PB 1..95 72..166 456 86.3 Plus
Ubc7-PB 167 CG4443-PB 9..162 10..163 437 55.2 Plus
Ubc7-PA 167 CG4443-PA 9..162 10..163 437 55.2 Plus
CG7656-PF 317 CG7656-PF 45..181 10..146 424 55.5 Plus
CG7656-PA 317 CG7656-PA 45..181 10..146 424 55.5 Plus
CG7656-PE 319 CG7656-PE 45..181 10..146 424 55.5 Plus
CG7656-PD 319 CG7656-PD 45..181 10..146 424 55.5 Plus
Ubc6-PC 151 CG2013-PC 9..148 10..163 295 39 Plus
Ubc6-PA 151 CG2013-PA 9..148 10..163 295 39 Plus
eff-PC 147 CG7425-PC 6..143 10..158 289 39.5 Plus
eff-PB 147 CG7425-PB 6..143 10..158 289 39.5 Plus
eff-PA 147 CG7425-PA 6..143 10..158 289 39.5 Plus
CG5440-PC 169 CG5440-PC 26..164 10..162 259 36.6 Plus
CG5440-PB 169 CG5440-PB 26..164 10..162 259 36.6 Plus
CG10862-PA 354 CG10862-PA 213..339 10..150 247 34.8 Plus
ben-PE 151 CG18319-PE 1..135 1..151 245 33.1 Plus
ben-PD 151 CG18319-PD 1..135 1..151 245 33.1 Plus
ben-PB 151 CG18319-PB 1..135 1..151 245 33.1 Plus
ben-PC 151 CG18319-PC 1..135 1..151 245 33.1 Plus
ben-PA 151 CG18319-PA 1..135 1..151 245 33.1 Plus
Ubc2-PD 232 CG6720-PD 91..221 10..154 233 34.5 Plus
Ubc2-PC 232 CG6720-PC 91..221 10..154 233 34.5 Plus
Ubc2-PB 232 CG6720-PB 91..221 10..154 233 34.5 Plus
Ubc2-PA 232 CG6720-PA 91..221 10..154 233 34.5 Plus
vih-PA 178 CG10682-PA 37..174 10..155 232 35.5 Plus
CG3473-PB 151 CG3473-PB 10..132 12..148 229 32.8 Plus
CG3473-PA 151 CG3473-PA 10..132 12..148 229 32.8 Plus
CG8188-PD 209 CG8188-PD 21..150 12..155 228 33.3 Plus
CG8188-PC 209 CG8188-PC 21..150 12..155 228 33.3 Plus
CG8188-PB 209 CG8188-PB 21..150 12..155 228 33.3 Plus
CG8188-PA 209 CG8188-PA 21..150 12..155 228 33.3 Plus
Ubc10-PA 154 CG5788-PA 7..150 10..166 223 27.4 Plus
lwr-PD 159 CG3018-PD 20..148 20..156 218 34.8 Plus
lwr-PC 159 CG3018-PC 20..148 20..156 218 34.8 Plus
lwr-PB 159 CG3018-PB 20..148 20..156 218 34.8 Plus
lwr-PA 159 CG3018-PA 20..148 20..156 218 34.8 Plus
CG2574-PA 239 CG2574-PA 67..194 10..151 210 29.6 Plus
morgue-PA 491 CG15437-PA 342..475 10..156 205 33.3 Plus
Ubc84D-PA 153 CG12799-PA 1..150 4..166 200 25.8 Plus
Ubc4-PC 199 CG8284-PC 43..141 42..152 195 35.7 Plus
Ubc4-PB 199 CG8284-PB 43..141 42..152 195 35.7 Plus
Ubc4-PA 199 CG8284-PA 43..141 42..152 195 35.7 Plus
CG17030-PA 180 CG17030-PA 35..158 29..165 192 28.1 Plus
UbcE2H-PB 183 CG2257-PB 33..151 37..166 180 32.1 Plus
UbcE2H-PC 183 CG2257-PC 33..151 37..166 180 32.1 Plus
UbcE2H-PA 183 CG2257-PA 33..151 37..166 180 32.1 Plus
UbcE2M-PC 181 CG7375-PC 59..166 41..161 175 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24418-PA 167 GI24418-PA 1..167 1..167 814 90.4 Plus
Dmoj\GI23981-PA 168 GI23981-PA 1..167 1..167 769 82.6 Plus
Dmoj\GI16154-PA 167 GI16154-PA 9..162 10..163 454 55.2 Plus
Dmoj\GI13630-PA 321 GI13630-PA 44..180 10..146 431 55.5 Plus
Dmoj\GI22506-PA 151 GI22506-PA 9..148 10..163 298 39 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24447-PA 167 GL24447-PA 1..167 1..167 793 87.4 Plus
Dper\GL12289-PA 170 GL12289-PA 16..169 14..167 714 83.1 Plus
Dper\GL18350-PA 167 GL18350-PA 9..162 10..163 446 55.2 Plus
Dper\GL22213-PA 151 GL22213-PA 9..148 10..163 298 39 Plus
Dper\GL23670-PA 147 GL23670-PA 6..143 10..158 295 39.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21906-PA 167 GA21906-PA 1..167 1..167 793 87.4 Plus
Dpse\GA26259-PA 170 GA26259-PA 16..169 14..167 715 83.1 Plus
Dpse\GA18185-PA 167 GA18185-PA 9..162 10..163 446 55.2 Plus
Dpse\GA15184-PA 151 GA15184-PA 9..148 10..163 298 39 Plus
Dpse\GA26693-PA 147 GA26693-PA 6..143 10..158 295 39.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25907-PA 168 GM25907-PA 1..168 1..168 880 98.8 Plus
Dsec\GM23423-PA 168 GM23423-PA 1..167 1..167 771 82.6 Plus
Dsec\GM10669-PA 151 GM10669-PA 9..148 10..163 298 39 Plus
Dsec\GM25828-PA 147 GM25828-PA 6..143 10..158 295 39.5 Plus
Dsec\GM24479-PA 271 GM24479-PA 43..133 56..146 266 53.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20475-PA 168 GD20475-PA 1..168 1..168 880 98.8 Plus
Dsim\GD11958-PA 168 GD11958-PA 1..167 1..167 771 82.6 Plus
Dsim\GD24840-PA 167 GD24840-PA 9..162 10..163 428 53.9 Plus
Dsim\GD19645-PA 151 GD19645-PA 9..148 10..163 298 39 Plus
Dsim\GD20402-PA 147 GD20402-PA 6..143 10..158 295 39.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14277-PA 220 GJ14277-PA 54..220 1..167 819 90.4 Plus
Dvir\GJ11187-PA 168 GJ11187-PA 1..167 1..167 771 82.6 Plus
Dvir\GJ16432-PA 167 GJ16432-PA 9..162 10..163 455 55.2 Plus
Dvir\GJ13967-PA 318 GJ13967-PA 44..180 10..146 427 55.5 Plus
Dvir\GJ10109-PA 151 GJ10109-PA 9..148 10..163 298 39 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13059-PA 167 GK13059-PA 1..167 1..167 840 93.4 Plus
Dwil\GK12909-PA 168 GK12909-PA 1..167 1..167 769 82.6 Plus
Dwil\GK16076-PA 167 GK16076-PA 9..162 10..163 440 54.5 Plus
Dwil\GK20435-PA 322 GK20435-PA 47..183 10..146 429 55.5 Plus
Dwil\GK19931-PA 294 GK19931-PA 14..151 10..146 327 45.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24416-PA 168 GE24416-PA 1..168 1..168 877 98.2 Plus
Dyak\GE15167-PA 168 GE15167-PA 1..167 1..167 771 82.6 Plus
Dyak\crl-PA 167 GE17278-PA 9..162 10..163 445 54.5 Plus
Dyak\GE25319-PA 151 GE25319-PA 9..148 10..163 298 39 Plus
Dyak\eff-PA 147 GE26430-PA 6..143 10..158 295 39.5 Plus