Clone GH25425 Report

Search the DGRC for GH25425

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:254
Well:25
Vector:pOT2
Associated Gene/TranscriptCG6180-RA
Protein status:GH25425.pep: gold
Preliminary Size:1184
Sequenced Size:1048

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6180 2001-01-01 Release 2 assignment
CG6180 2001-11-09 Blastp of sequenced clone
CG6180 2003-01-01 Sim4 clustering to Release 3
CG6180 2008-04-29 Release 5.5 accounting
CG6180 2008-08-15 Release 5.9 accounting
CG6180 2008-12-18 5.12 accounting

Clone Sequence Records

GH25425.complete Sequence

1048 bp (1048 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069195

> GH25425.complete
GCAAATAGAACAATAAACAGTTTTTTAATTAATCCAATTTGGTTTACTTA
AGCAATAAGGATGATTTGTATGCGGCTCCGGGTGTTGCGTAATCTCAATC
GCAGCGCTTTAAATGGATTTAGAAAAGATTACATCCGATCAACCGGTGTG
AATGTCAATTATTCAGCTGTCAACTTTCCGGCCGCCATTAGAACGCTGAA
AACTTTTAGCAATTCTATCCTAACCAAGGAACCGAAACCAATCTTTGCAT
TTATCGCATCTCAGCGGCAGTATTCTTGCGAAAAAGTAGGCAAAACAATG
GAGGAGCACTGCGTAGTTCCGGATGTGATCGCCAAGGCACCGGCGCAGAC
AGCTGTGGTGGAATATCCCGGCGATATTGTCGTGAAGCCGGGTCAGGTCC
TGACCCCCACCCAGGTGAAGGATGAGCCGTGCGTGAAATGGGAGGCGGAC
GCCAATAAGCTGTACACCCTCTGCATGACCGATCCGGATGCGCCCAGTCG
CAAGGATCCCAAGTTTAGGGAGTGGCACCATTGGCTGGTGGGCAACATAC
CCGGTGGAGATGTCGCCAAGGGCGAGGTTCTCTCCGCCTACGTGGGATCC
GGGCCTCCACCAGACACCGGACTCCATCGTTACGTTTTCCTGATCTACGA
GCAGCGGTGCAAGCTCACATTCGACGAGAAGCGACTGCCCAATAACAGCG
GAGATGGACGCGGTGGCTTCAAAATCGCCGAGTTCGCCAAGAAGTACGCC
CTCGGCAATCCCATTGCCGGTAACCTCTACCAGGCTGAGTACGACGACTA
TGTGCCCATCCTCTACAAGCAGCTGGGCGCTTAGTTTCTACGCCAAAAAC
CATGCTTATATAAGCCAGTCTGAATTGGATTCAAATCTATTGTAACCTAG
AAATTAAAGACACCTATGAACACTCTGTGAAACCCTCTGTTGCTGGCAAT
AAAATTGTTAAAGACATATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH25425.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG6180-RA 1024 CG6180-RA 51..1022 1..972 4860 100 Plus
CG6180.a 991 CG6180.a 68..989 51..972 4610 100 Plus
CG10298-RA 770 CG10298-RA 280..362 463..545 265 87.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12706412..12707381 1..970 4850 100 Plus
chr3R 27901430 chr3R 2168986..2169169 463..646 275 76.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:07:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12707711..12708682 1..972 4860 100 Plus
3R 32079331 3R 6343309..6343492 463..646 275 76.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12707711..12708682 1..972 4860 100 Plus
3R 31820162 3R 6084140..6084222 463..545 265 87.9 Plus
Blast to na_te.dros performed on 2019-03-15 12:37:30 has no hits.

GH25425.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:38:31 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12706412..12707381 1..970 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:55:58 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
CG6180-RA 1..774 61..834 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:40:07 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
CG6180-RA 1..774 61..834 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:44 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
CG6180-RA 1..774 61..834 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:17:29 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
CG6180-RA 1..774 61..834 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:06:24 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
CG6180-RA 1..774 61..834 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:45:27 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
CG6180-RA 51..1020 1..970 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:40:06 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
CG6180-RA 51..1020 1..970 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:44 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
CG6180-RA 51..1020 1..970 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:17:29 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
CG6180-RA 51..1020 1..970 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:06:24 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
CG6180-RA 51..1020 1..970 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:31 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12707711..12708680 1..970 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:31 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12707711..12708680 1..970 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:31 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12707711..12708680 1..970 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:44 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12707711..12708680 1..970 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:53:06 Download gff for GH25425.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12707711..12708680 1..970 100   Plus

GH25425.hyp Sequence

Translation from 60 to 833

> GH25425.hyp
MICMRLRVLRNLNRSALNGFRKDYIRSTGVNVNYSAVNFPAAIRTLKTFS
NSILTKEPKPIFAFIASQRQYSCEKVGKTMEEHCVVPDVIAKAPAQTAVV
EYPGDIVVKPGQVLTPTQVKDEPCVKWEADANKLYTLCMTDPDAPSRKDP
KFREWHHWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRC
KLTFDEKRLPNNSGDGRGGFKIAEFAKKYALGNPIAGNLYQAEYDDYVPI
LYKQLGA*

GH25425.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG6180-PA 257 CG6180-PA 1..257 1..257 1374 100 Plus
CG10298-PA 187 CG10298-PA 10..183 82..255 572 59.8 Plus
CG17919-PA 202 CG17919-PA 20..199 76..255 544 56.7 Plus
Pebp1-PA 176 CG18594-PA 1..171 80..251 469 50 Plus
a5-PA 210 CG5430-PA 17..205 67..255 453 40.7 Plus

GH25425.pep Sequence

Translation from 60 to 833

> GH25425.pep
MICMRLRVLRNLNRSALNGFRKDYIRSTGVNVNYSAVNFPAAIRTLKTFS
NSILTKEPKPIFAFIASQRQYSCEKVGKTMEEHCVVPDVIAKAPAQTAVV
EYPGDIVVKPGQVLTPTQVKDEPCVKWEADANKLYTLCMTDPDAPSRKDP
KFREWHHWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRC
KLTFDEKRLPNNSGDGRGGFKIAEFAKKYALGNPIAGNLYQAEYDDYVPI
LYKQLGA*

GH25425.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14208-PA 260 GF14208-PA 1..260 1..257 1013 73.9 Plus
Dana\GF16395-PA 186 GF16395-PA 8..185 80..257 583 59.6 Plus
Dana\GF16396-PA 202 GF16396-PA 5..201 61..257 565 53.3 Plus
Dana\GF23379-PA 176 GF23379-PA 1..175 80..255 465 48.9 Plus
Dana\GF23378-PA 175 GF23378-PA 4..173 85..255 459 55.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23796-PA 178 GG23796-PA 1..178 80..257 954 98.9 Plus
Dere\GG13336-PA 187 GG13336-PA 8..185 80..257 572 58.4 Plus
Dere\GG13347-PA 202 GG13347-PA 17..200 73..256 561 56.5 Plus
Dere\GG11139-PA 176 GG11139-PA 1..171 80..251 475 50 Plus
Dere\GG24786-PA 210 GG24786-PA 20..205 70..255 454 43 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13213-PA 178 GH13213-PA 1..178 80..257 841 87.1 Plus
Dgri\GH14039-PA 186 GH14039-PA 4..185 76..257 583 55.5 Plus
Dgri\GH14040-PA 202 GH14040-PA 20..200 76..256 563 58 Plus
Dgri\GH23119-PA 188 GH23119-PA 13..184 75..246 491 50.6 Plus
Dgri\GH22229-PA 177 GH22229-PA 4..175 85..255 461 52.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6180-PA 257 CG6180-PA 1..257 1..257 1374 100 Plus
CG10298-PA 187 CG10298-PA 10..183 82..255 572 59.8 Plus
CG17919-PA 202 CG17919-PA 20..199 76..255 544 56.7 Plus
Pebp1-PA 176 CG18594-PA 1..171 80..251 469 50 Plus
a5-PA 210 CG5430-PA 17..205 67..255 453 40.7 Plus
CG7054-PA 179 CG7054-PA 4..177 85..255 442 52.6 Plus
CG17917-PA 211 CG17917-PA 21..201 75..255 401 44.2 Plus
CG30060-PA 202 CG30060-PA 12..179 74..244 325 39.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14504-PA 178 GI14504-PA 1..178 80..257 783 80.3 Plus
Dmoj\GI24413-PA 183 GI24413-PA 7..182 82..257 590 61.4 Plus
Dmoj\GI24414-PA 202 GI24414-PA 17..200 73..256 508 51.1 Plus
Dmoj\GI21978-PA 177 GI21978-PA 1..176 80..256 482 50.8 Plus
Dmoj\GI18941-PA 187 GI18941-PA 13..184 75..246 463 49.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19726-PA 256 GL19726-PA 1..256 1..257 991 72.1 Plus
Dper\GL24079-PA 203 GL24079-PA 21..201 76..256 588 61.3 Plus
Dper\GL24078-PA 189 GL24078-PA 2..185 72..255 578 58.2 Plus
Dper\GL24219-PA 179 GL24219-PA 4..175 85..253 450 52 Plus
Dper\GL24075-PA 220 GL24075-PA 21..205 71..255 418 45.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19416-PA 256 GA19416-PA 1..256 1..257 1000 72.5 Plus
Dpse\GA14724-PA 203 GA14724-PA 16..201 71..256 591 60.2 Plus
Dpse\GA10227-PA 189 GA10227-PA 2..185 72..255 586 58.7 Plus
Dpse\GA15006-PA 176 GA15006-PA 1..175 80..255 454 47.7 Plus
Dpse\GA20063-PA 179 GA20063-PA 4..175 85..253 448 52 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10048-PA 178 GM10048-PA 1..178 80..257 960 100 Plus
Dsec\GM10887-PA 202 GM10887-PA 17..200 73..256 550 55.4 Plus
Dsec\GM10886-PA 187 GM10886-PA 8..185 80..257 543 57.9 Plus
Dsec\GM26437-PA 176 GM26437-PA 1..171 80..251 476 50 Plus
Dsec\GM16814-PA 210 GM16814-PA 10..205 61..255 456 40.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23851-PA 178 GD23851-PA 1..178 80..257 960 100 Plus
Dsim\GD19865-PA 187 GD19865-PA 8..185 80..257 559 59.6 Plus
Dsim\GD19866-PA 202 GD19866-PA 20..200 76..256 553 56.9 Plus
Dsim\GD20954-PA 176 GD20954-PA 1..171 80..251 475 50 Plus
Dsim\GD20953-PA 179 GD20953-PA 4..177 85..255 455 53.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16279-PA 226 GJ16279-PA 4..226 32..257 917 75.1 Plus
Dvir\GJ14271-PA 186 GJ14271-PA 6..185 78..257 587 59.4 Plus
Dvir\GJ14272-PA 200 GJ14272-PA 8..198 65..255 518 51.8 Plus
Dvir\GJ21315-PA 188 GJ21315-PA 13..184 75..246 488 54.1 Plus
Dvir\GJ14338-PA 176 GJ14338-PA 1..175 80..255 478 50.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14662-PA 256 GK14662-PA 38..256 37..257 840 73.2 Plus
Dwil\GK13055-PA 191 GK13055-PA 8..189 76..257 613 59.9 Plus
Dwil\GK13056-PA 202 GK13056-PA 4..200 61..256 608 59.9 Plus
Dwil\GK11699-PA 174 GK11699-PA 1..173 80..255 509 54.5 Plus
Dwil\GK11698-PA 176 GK11698-PA 1..175 80..255 492 52.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18600-PA 178 GE18600-PA 1..178 80..257 943 97.8 Plus
Dyak\GE10210-PA 187 GE10210-PA 8..185 80..257 580 59 Plus
Dyak\GE10211-PA 202 GE10211-PA 20..200 76..256 545 55.8 Plus
Dyak\GE10305-PA 176 GE10305-PA 1..171 80..251 474 50 Plus
Dyak\GE10304-PA 179 GE10304-PA 4..177 85..255 442 53.1 Plus