Clone GH25431 Report

Search the DGRC for GH25431

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:254
Well:31
Vector:pOT2
Associated Gene/TranscriptCG1835-RA
Protein status:GH25431.pep: gold
Preliminary Size:861
Sequenced Size:698

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1835 2002-01-01 Sim4 clustering to Release 2
CG1835 2002-06-05 Blastp of sequenced clone
CG1835 2003-01-01 Sim4 clustering to Release 3
CG1835 2008-04-29 Release 5.5 accounting
CG1835 2008-08-15 Release 5.9 accounting
CG1835 2008-12-18 5.12 accounting

Clone Sequence Records

GH25431.complete Sequence

698 bp (698 high quality bases) assembled on 2002-06-05

GenBank Submission: AY119544

> GH25431.complete
CAGAAATCTTACAAAATTACAGTCAGCTACATAGTATTTGTTTAACAATT
TTGATTTCAAATTATTGCAAGTAAACGATGCAGCCCCGAAATAAATTAAG
CAAGTGTTTGATCTATATAACGCCCTGTGTGCAGCAATTGTGTTTCTATG
GCACTAGGCGACATTTACTGGCCATGCAGTCCTTGTCCGCCCAAAGGAAT
CGGAAGTCTGATGTCTCCGAAAAGAAGGCAGTAGAGACAACAGTCGAATG
GGGGCGTGGCCCCCAAGCGGGCGACCGCCTTCCAACAGCCGTTAGTCTGC
TCCGTCGAAATTCGACAGATTCCGCGAGGAACGAGGTGAAAACCGCATTC
ATTCGATACGAAAAGTCTATGAACGAATTGGCCAAAAGTGCCCGAAAGCT
ATATAAAAATGCCCGGCTAAGGAGCTTGCCTTTGAGGAAGCCCATGATGC
GAGGAAAAATCGGTGACTCTGATGCAAGACCCCTAAGAACACCGGTGCCC
AGTGCTTGGGCCATAACCGAGCGGGAAAATAAATAGCTGGCATAAGCAGA
AGAGATGGTTTTAAGGCAAGGAAATGCGTGTAAATGCGTGTAATTTTACT
TAAGTCTGTAGATATATATCCAAATATATTTTTCCTTAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH25431.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG1835-RA 713 CG1835-RA 77..713 1..637 3185 100 Plus
CG1835.a 680 CG1835.a 55..636 1..583 2875 99.8 Plus
CG1835-RB 704 CG1835-RB 77..660 1..583 2850 99.4 Plus
CG1835.a 680 CG1835.a 625..677 582..634 250 98.1 Plus
CG1835-RB 704 CG1835-RB 649..701 582..634 235 96.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20534509..20534834 139..464 1600 99.4 Plus
chrX 22417052 chrX 20534896..20535071 462..637 880 100 Plus
chrX 22417052 chrX 20535291..20535465 462..637 830 99.4 Plus
chrX 22417052 chrX 20533756..20533893 1..138 690 100 Plus
chrX 22417052 chrX 20535685..20535846 462..634 615 93.1 Plus
chrX 22417052 chrX 20536071..20536234 462..634 605 91.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:07:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20669107..20669432 139..464 1630 100 Plus
X 23542271 X 20669494..20669674 462..642 905 100 Plus
X 23542271 X 20669889..20670068 462..642 855 99.4 Plus
X 23542271 X 20668354..20668491 1..138 690 100 Plus
X 23542271 X 20670283..20670452 462..642 640 92.8 Plus
X 23542271 X 20670669..20670840 462..642 630 91.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20654199..20654524 139..464 1630 100 Plus
X 23527363 X 20654586..20654766 462..642 905 100 Plus
X 23527363 X 20654981..20655160 462..642 865 99.4 Plus
X 23527363 X 20653446..20653583 1..138 690 100 Plus
X 23527363 X 20655375..20655495 462..583 570 99.1 Plus
X 23527363 X 20655761..20655883 462..583 545 97.5 Plus
X 23527363 X 20655484..20655544 582..642 275 96.7 Plus
X 23527363 X 20655872..20655932 582..642 260 95 Plus
Blast to na_te.dros performed 2019-03-16 23:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
transib4 2656 transib4 TRANSIB4 2656bp 1736..1792 36..92 114 66.7 Plus

GH25431.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:59:32 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20533756..20533893 1..138 100 -> Plus
chrX 20534509..20534832 139..462 99 -> Plus
chrX 20534897..20535071 463..637 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:55:59 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
CG1835-RA 1..459 78..536 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:18 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
CG1835-RA 1..459 78..536 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:55:19 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
CG1835-RA 1..459 78..536 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:19 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
CG1835-RA 1..459 78..536 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:06:37 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
CG1835-RA 1..459 78..536 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:03 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
CG1835-RA 33..669 1..637 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:18 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
CG1835-RA 27..663 1..637 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:55:19 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
CG1835-RA 27..663 1..637 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:20 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
CG1835-RA 33..669 1..637 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:06:37 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
CG1835-RA 27..663 1..637 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:59:32 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
X 20668354..20668491 1..138 100 -> Plus
X 20669107..20669430 139..462 100 -> Plus
X 20669495..20669669 463..637 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:59:32 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
X 20668354..20668491 1..138 100 -> Plus
X 20669107..20669430 139..462 100 -> Plus
X 20669495..20669669 463..637 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:59:32 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
X 20668354..20668491 1..138 100 -> Plus
X 20669107..20669430 139..462 100 -> Plus
X 20669495..20669669 463..637 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:55:19 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20539381..20539518 1..138 100 -> Plus
arm_X 20540134..20540457 139..462 100 -> Plus
arm_X 20540522..20540696 463..637 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:09 Download gff for GH25431.complete
Subject Subject Range Query Range Percent Splice Strand
X 20654199..20654522 139..462 100 -> Plus
X 20654587..20654761 463..637 100   Plus
X 20653446..20653583 1..138 100 -> Plus

GH25431.hyp Sequence

Translation from 77 to 535

> GH25431.hyp
MQPRNKLSKCLIYITPCVQQLCFYGTRRHLLAMQSLSAQRNRKSDVSEKK
AVETTVEWGRGPQAGDRLPTAVSLLRRNSTDSARNEVKTAFIRYEKSMNE
LAKSARKLYKNARLRSLPLRKPMMRGKIGDSDARPLRTPVPSAWAITERE
NK*

GH25431.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG1835-PA 152 CG1835-PA 1..152 1..152 780 100 Plus
CG1835-PC 120 CG1835-PC 1..120 33..152 604 100 Plus

GH25431.pep Sequence

Translation from 77 to 535

> GH25431.pep
MQPRNKLSKCLIYITPCVQQLCFYGTRRHLLAMQSLSAQRNRKSDVSEKK
AVETTVEWGRGPQAGDRLPTAVSLLRRNSTDSARNEVKTAFIRYEKSMNE
LAKSARKLYKNARLRSLPLRKPMMRGKIGDSDARPLRTPVPSAWAITERE
NK*

GH25431.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19695-PA 183 GG19695-PA 1..123 1..123 413 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG1835-PA 152 CG1835-PA 1..152 1..152 780 100 Plus
CG1835-PC 120 CG1835-PC 1..120 33..152 604 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17893-PA 163 GE17893-PA 1..150 1..152 444 63.8 Plus