GH25462.complete Sequence
789 bp (789 high quality bases) assembled on 2002-06-07
GenBank Submission: AY119545
> GH25462.complete
AAAATTCGACGTTGCTGTTTTTTTTGGTTTAACATTCTCTATATACATTT
TTTTAAAAATATGGATATAACGGTACCGCCGCCGGACTCGCACTGGTCGT
TGAGGTTTGTGGACATCGTGAAGCCTTTTCCAAAACATACTTTGGCCAAT
GCCACTTATAAGATCATTCGCTTCTTTTACCCACCCTTTGCCCTGGAAAC
CGTCGATGTCACCCACGTGGTCAGCGATCCCGAGCTGAATAGTTTAAACG
TGGGGCTGTTTGTGGTAGTTCCCTTAATTCTGGCCTGCATCGGCTATGGG
GTGTACAAATATGTGCGGAGTATGCATACAGTGGCTAAACGGACACCATT
AAAATTGTACGAGCTTGAACAGCGTATGAAAGACAAGTACGGTCCGGAAT
ACAAGCAGGGAATCTGGAAGCGAAAGGACATTTCTGACCCCCTCCTATTA
ACCACTGATCCATCCGAACCAAAAGCAAAGAGATGTGAAAGCAGCAATGC
CCACTGGCTGCGCAAAACCGATAGATCCGATGATTAATTAAATCAACACT
CAGTTGGATCCCCACTCGGATATGACTGGGGATCTTAAAATCGAGAATCG
AGGAAAGTACCTTCTCGAATCCAACCAGGCTTTGTACCCTTCTAAGCAAC
AAAATCGATATGATCCTTCAATTCCGTTTAATGATTGAGACCTTTTTTGC
GACTGGAAAAGTGTCAGCTTTGGGCTTTCTCGTTTGGCGCAATAAAATGA
AGTGATTGTTTGGTTAAAAAAAAAAAAAAAAAAAAAAAA
GH25462.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:25:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32450.a | 1669 | CG32450.a | 741..1505 | 1..765 | 3825 | 100 | Plus |
CG32450-RA | 1056 | CG32450-RA | 128..892 | 1..765 | 3825 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:51:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 22319127..22319568 | 324..765 | 2210 | 100 | Plus |
chr3L | 24539361 | chr3L | 22318745..22319068 | 1..324 | 1620 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:07:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:51:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 22330216..22330657 | 324..765 | 2210 | 100 | Plus |
3L | 28110227 | 3L | 22329834..22330157 | 1..324 | 1620 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 22323316..22323757 | 324..765 | 2210 | 100 | Plus |
3L | 28103327 | 3L | 22322934..22323257 | 1..324 | 1620 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 03:51:03 has no hits.
GH25462.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:52:22 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 22318745..22319068 | 1..324 | 100 | -> | Plus |
chr3L | 22319128..22319568 | 325..765 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:56:01 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32450-RA | 1..477 | 61..537 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:28 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32450-RA | 1..477 | 61..537 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:06:02 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32450-RA | 1..477 | 61..537 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:23 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32450-RA | 1..477 | 61..537 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:17:03 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32450-RA | 1..477 | 61..537 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:12:13 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32450-RA | 57..821 | 1..765 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:28 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32450-RA | 57..821 | 1..765 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:06:02 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32450-RA | 57..821 | 1..765 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:23 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32450-RA | 57..821 | 1..765 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:17:03 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32450-RA | 57..821 | 1..765 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:22 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22329834..22330157 | 1..324 | 100 | -> | Plus |
3L | 22330217..22330657 | 325..765 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:22 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22329834..22330157 | 1..324 | 100 | -> | Plus |
3L | 22330217..22330657 | 325..765 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:22 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22329834..22330157 | 1..324 | 100 | -> | Plus |
3L | 22330217..22330657 | 325..765 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:06:02 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 22323317..22323757 | 325..765 | 100 | | Plus |
arm_3L | 22322934..22323257 | 1..324 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:38 Download gff for
GH25462.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22322934..22323257 | 1..324 | 100 | -> | Plus |
3L | 22323317..22323757 | 325..765 | 100 | | Plus |
GH25462.hyp Sequence
Translation from 0 to 536
> GH25462.hyp
KIRRCCFFWFNILYIHFFKNMDITVPPPDSHWSLRFVDIVKPFPKHTLAN
ATYKIIRFFYPPFALETVDVTHVVSDPELNSLNVGLFVVVPLILACIGYG
VYKYVRSMHTVAKRTPLKLYELEQRMKDKYGPEYKQGIWKRKDISDPLLL
TTDPSEPKAKRCESSNAHWLRKTDRSDD*
GH25462.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:28:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32450-PA | 158 | CG32450-PA | 1..158 | 21..178 | 848 | 100 | Plus |
GH25462.pep Sequence
Translation from 60 to 536
> GH25462.pep
MDITVPPPDSHWSLRFVDIVKPFPKHTLANATYKIIRFFYPPFALETVDV
THVVSDPELNSLNVGLFVVVPLILACIGYGVYKYVRSMHTVAKRTPLKLY
ELEQRMKDKYGPEYKQGIWKRKDISDPLLLTTDPSEPKAKRCESSNAHWL
RKTDRSDD*
GH25462.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:04:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10976-PA | 235 | GF10976-PA | 1..159 | 1..150 | 370 | 47.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:04:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16253-PA | 219 | GG16253-PA | 1..175 | 1..158 | 623 | 69.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32450-PA | 158 | CG32450-PA | 1..158 | 1..158 | 848 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:04:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM22441-PA | 213 | GM22441-PA | 1..164 | 1..158 | 662 | 81.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:04:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15026-PA | 214 | GD15026-PA | 1..165 | 1..158 | 705 | 84.2 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:04:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ11631-PA | 109 | GJ11631-PA | 11..56 | 13..58 | 132 | 52.2 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:04:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK13087-PA | 100 | GK13087-PA | 3..92 | 2..93 | 168 | 38.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:04:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE22613-PA | 218 | GE22613-PA | 1..160 | 1..150 | 628 | 75.6 | Plus |
Dyak\GE22612-PA | 218 | GE22612-PA | 1..160 | 1..150 | 628 | 75.6 | Plus |