Clone GH25733 Report

Search the DGRC for GH25733

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:257
Well:33
Vector:pOT2
Associated Gene/TranscriptCG6971-RA
Protein status:GH25733.pep: gold
Preliminary Size:1165
Sequenced Size:987

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6971 2001-01-01 Release 2 assignment
CG6971 2001-11-09 Blastp of sequenced clone
CG6971 2003-01-01 Sim4 clustering to Release 3
CG6971 2008-04-29 Release 5.5 accounting
CG6971 2008-08-15 Release 5.9 accounting
CG6971 2008-12-18 5.12 accounting

Clone Sequence Records

GH25733.complete Sequence

987 bp (987 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069202

> GH25733.complete
CAAACCTGCTGAATTCCTGAATTACACAAATATAAATTAAAAATATATAT
ATTTTTTGAGATAGGAATCGAGAAATTGAAATAGTACCAACAAAATGGAG
GAGCTGGATATAACAAGCGTGGGTCAATTCCAGACCCTGGTGCGCTACAA
CAACCCGGTGCTGGTGGTGAAGCACCCGGACAAGAAAGGGGGTGCTCCGC
TCACAGAGATAGAGATGAAAAGGCCCCAAACGGCGGGCGCTTTGCTAGAT
ACCAAAAGGGAAACTGAGGAAATTCTAAATTCTATATTGCCACCGCGCTG
CTGGGAGGAGGATGGCCAGTTGTGGCAGCAGTCTGTGTCCAGTACTCCAG
CAACACGCCAGGATGTGATCAATTTGCAGGAGATGCTTGATACTAGGCTG
CAGCAGACCCAAGCTCGTGAGACAGGTATTTGTCCCGTGCGCCGCGAGCT
GTACTCACAATGTTTTGACGAGATCATTCGCCAGGTCACCATTAACTGTT
CAGAGCGTGGCCTGCTACTGCTTCGCATCCGCGATGAGATCGCCATGTCA
ATGGAGGCCTATGAAACATTGTACTGCAGTTCCGTAGCCTTTGGCATGCG
CAAGGCTTTGCAGGCGCATGAGGAAAAGGAAATGCTTCGTGATCGGGTCA
AGACTCTTGAACTAGACAAAGAGGCACTAGAGGAGATAATCGCAGATATG
AAACTTAAGCAGGAACAGGCAGAGCGTCGTAATGCTGAGCTGAGGGCCTC
TGAAGAAAAGAAGTTCACGGAGGAGATAACTTTCCTGAAGAAGACCAACG
CTCAGCTGAAGGCTCAGCTAGAGGGCATAACCGCACCCAAGAAGTAAACG
GAAATTTATGGAGTGTGGTCTATGCGTTTTTGATTTGTCACTTTAACTTT
GTTGGAACTTAATGAAATTAAATTATTTGAGCAACTGAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH25733.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG6971-RA 1004 CG6971-RA 68..1004 1..937 4685 100 Plus
CG31368-RD 4679 CG31368-RD 4562..4679 939..822 590 100 Minus
CG31368.a 4649 CG31368.a 4568..4649 939..858 410 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7717792..7718262 937..467 2355 100 Minus
chr3R 27901430 chr3R 7718315..7718781 467..1 2335 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:07:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11892304..11892776 939..467 2365 100 Minus
3R 32079331 3R 11892829..11893295 467..1 2335 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11633135..11633607 939..467 2365 100 Minus
3R 31820162 3R 11633660..11634126 467..1 2335 100 Minus
Blast to na_te.dros performed 2019-03-16 10:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 6764..6800 57..21 113 78.4 Minus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6892..6926 29..63 112 80 Plus

GH25733.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:28:34 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7717792..7718261 468..937 100 <- Minus
chr3R 7718315..7718781 1..467 93   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:56:17 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 1..753 95..847 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:33:54 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 1..753 95..847 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:02:03 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 1..753 95..847 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:01:28 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 1..753 95..847 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:09:24 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 1..753 95..847 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:13:09 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 3..936 1..934 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:33:54 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 3..936 1..934 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:02:03 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 3..939 1..937 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:01:28 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 3..936 1..934 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:09:24 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 3..939 1..937 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:28:34 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11892306..11892775 468..937 100 <- Minus
3R 11892829..11893295 1..467 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:28:34 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11892306..11892775 468..937 100 <- Minus
3R 11892829..11893295 1..467 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:28:34 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11892306..11892775 468..937 100 <- Minus
3R 11892829..11893295 1..467 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:02:03 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7718028..7718497 468..937 100 <- Minus
arm_3R 7718551..7719017 1..467 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:38:22 Download gff for GH25733.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11633137..11633606 468..937 100 <- Minus
3R 11633660..11634126 1..467 100   Minus

GH25733.hyp Sequence

Translation from 94 to 846

> GH25733.hyp
MEELDITSVGQFQTLVRYNNPVLVVKHPDKKGGAPLTEIEMKRPQTAGAL
LDTKRETEEILNSILPPRCWEEDGQLWQQSVSSTPATRQDVINLQEMLDT
RLQQTQARETGICPVRRELYSQCFDEIIRQVTINCSERGLLLLRIRDEIA
MSMEAYETLYCSSVAFGMRKALQAHEEKEMLRDRVKTLELDKEALEEIIA
DMKLKQEQAERRNAELRASEEKKFTEEITFLKKTNAQLKAQLEGITAPKK
*

GH25733.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG6971-PA 250 CG6971-PA 1..250 1..250 1263 100 Plus

GH25733.pep Sequence

Translation from 94 to 846

> GH25733.pep
MEELDITSVGQFQTLVRYNNPVLVVKHPDKKGGAPLTEIEMKRPQTAGAL
LDTKRETEEILNSILPPRCWEEDGQLWQQSVSSTPATRQDVINLQEMLDT
RLQQTQARETGICPVRRELYSQCFDEIIRQVTINCSERGLLLLRIRDEIA
MSMEAYETLYCSSVAFGMRKALQAHEEKEMLRDRVKTLELDKEALEEIIA
DMKLKQEQAERRNAELRASEEKKFTEEITFLKKTNAQLKAQLEGITAPKK
*

GH25733.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23056-PA 249 GF23056-PA 1..249 1..250 1291 98.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17181-PA 250 GG17181-PA 1..250 1..250 1316 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18777-PA 249 GH18777-PA 1..249 1..250 1264 96 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG6971-PA 250 CG6971-PA 1..250 1..250 1263 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22668-PA 249 GI22668-PA 1..249 1..250 1258 95.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12363-PA 249 GL12363-PA 1..249 1..250 1273 97.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19994-PA 249 GA19994-PA 1..249 1..250 1273 97.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26061-PA 250 GM26061-PA 1..250 1..250 1316 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20624-PA 250 GD20624-PA 1..250 1..250 1316 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23395-PA 249 GJ23395-PA 1..249 1..250 1261 95.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14471-PA 249 GK14471-PA 1..249 1..250 1271 96.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10075-PA 250 GE10075-PA 1..250 1..250 1316 100 Plus