BDGP Sequence Production Resources |
Search the DGRC for GH25884
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 258 |
Well: | 84 |
Vector: | pOT2 |
Associated Gene/Transcript | Vps29-RA |
Protein status: | GH25884.pep: gold |
Preliminary Size: | 1136 |
Sequenced Size: | 1003 |
Gene | Date | Evidence |
---|---|---|
CG4764 | 2001-01-01 | Release 2 assignment |
CG4764 | 2001-10-10 | Blastp of sequenced clone |
CG4764 | 2003-01-01 | Sim4 clustering to Release 3 |
CG4764 | 2008-04-29 | Release 5.5 accounting |
CG4764 | 2008-08-15 | Release 5.9 accounting |
CG4764 | 2008-12-18 | 5.12 accounting |
1003 bp (1003 high quality bases) assembled on 2001-10-10
GenBank Submission: AY060789
> GH25884.complete ATCGCAGCCACCTATCGTTTAATTCGCTGGGCGTTTCACAATTTTTTTGG GAAACACAACAAAGCTTCACAAAGGACACGATGCTCGTTCTGGTACTCGG CGACCTGCACATCCCGCACCGGTGCAGCAGCCTGCCGGCTAAATTTAAGA AGCTGCTGGTGCCGGGCCGCATACATCACATCCTGGCCACCGGAAACATC TGCACCAAGGAGTCCTACGACTACCTGAAGTCCCTGGCCAATGATGTGCA CATAGTGCGCGGCGACTTCGACGAGAACCTGACGTATCCGGAGCAGAAGG TGGTCACGGTAGGCCAGTTCCGGATCGGTCTGTGCCACGGCCACCAGGTG GTTCCCCGCGGAGACCCGGAGGCGCTGGCCCTCATCCAGCGGCAACTGGA CGTGGACATCCTGATCACGGGGCACACGTACAAGTTCGAGGCCTACGAGC ACGGCAACAAATTCTACATCAATCCGGGATCGGCCACGGGTGCCTTCAAC CCACTGGACACCAATGTGGTGCCTTCGTTCGTGCTGATGGACATTCAGAG CACCACGGTGGTCACGTACGTGTACCAACTGATCGGCGACGAGGTCAAAG TGGAGCGCATCGAGTACAAGAAGATCTAGGGTCCTAGTATTAGCCACCAG CCATTCCCCTCCAATCCAACCCTTGACCCCTGCATTCTGAGCTCGGCTTC ATTAAAGAAATTGTAAATGTACGTAGCAATAAATCAAGTTCTCATTTTTT TATCTGATAAAAAATGCTAGCACCTTGTTTAAATAGAGAATAAAAGTACG AACGGACGAAAGTGAAGTTTTAGATTTAATGCAATAATAAACGATTACAA AGTAAGGAAAAACACCCCCAGAAATTGTGATACTCCCACAATAATCTGAT AAAAAAGTTTAAATTTTATTAAATAGAATATAAAAAGGAGTTACATCTGA TGATCGAGTAAAGAGTCTGCTCAAAAGTTCGGAAAAAAAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 1150700..1151681 | 1..982 | 4805 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 1150783..1151765 | 1..983 | 4915 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 1150783..1151765 | 1..983 | 4915 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
HB | 1653 | HB DMTHB1 1653bp Derived from X01748 (g8693) (Rel. 49, Last updated, Version 3). | 392..487 | 833..928 | 137 | 62.9 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 1150700..1151681 | 1..982 | 95 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4764-RA | 1..549 | 81..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4764-RA | 1..549 | 81..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4764-RA | 1..549 | 81..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4764-RA | 1..549 | 81..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps29-RA | 1..549 | 81..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4764-RA | 1..982 | 1..982 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4764-RA | 1..982 | 1..982 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4764-RA | 18..999 | 1..982 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4764-RA | 1..982 | 1..982 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps29-RA | 18..999 | 1..982 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1150783..1151764 | 1..982 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1150783..1151764 | 1..982 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1150783..1151764 | 1..982 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 1150783..1151764 | 1..982 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1150783..1151764 | 1..982 | 100 | Plus |
Translation from 2 to 628
> GH25884.hyp RSHLSFNSLGVSQFFWETQQSFTKDTMLVLVLGDLHIPHRCSSLPAKFKK LLVPGRIHHILATGNICTKESYDYLKSLANDVHIVRGDFDENLTYPEQKV VTVGQFRIGLCHGHQVVPRGDPEALALIQRQLDVDILITGHTYKFEAYEH GNKFYINPGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVYQLIGDEVKV ERIEYKKI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Vps29-PA | 182 | CG4764-PA | 1..182 | 27..208 | 956 | 100 | Plus |
Translation from 80 to 628
> GH25884.pep MLVLVLGDLHIPHRCSSLPAKFKKLLVPGRIHHILATGNICTKESYDYLK SLANDVHIVRGDFDENLTYPEQKVVTVGQFRIGLCHGHQVVPRGDPEALA LIQRQLDVDILITGHTYKFEAYEHGNKFYINPGSATGAFNPLDTNVVPSF VLMDIQSTTVVTYVYQLIGDEVKVERIEYKKI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15167-PA | 182 | GF15167-PA | 1..182 | 1..182 | 959 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24770-PA | 182 | GG24770-PA | 1..182 | 1..182 | 961 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11176-PA | 182 | GH11176-PA | 1..182 | 1..182 | 953 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Vps29-PA | 182 | CG4764-PA | 1..182 | 1..182 | 956 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17980-PA | 182 | GI17980-PA | 1..182 | 1..182 | 953 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15595-PA | 182 | GL15595-PA | 1..182 | 1..182 | 951 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18414-PA | 182 | GA18414-PA | 1..182 | 1..182 | 951 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16798-PA | 182 | GM16798-PA | 1..182 | 1..182 | 961 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23074-PA | 182 | GD23074-PA | 1..182 | 1..182 | 961 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19542-PA | 182 | GJ19542-PA | 1..182 | 1..182 | 959 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24671-PA | 182 | GK24671-PA | 1..182 | 1..182 | 955 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17363-PA | 182 | GE17363-PA | 1..182 | 1..182 | 961 | 100 | Plus |