Clone GH25884 Report

Search the DGRC for GH25884

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:258
Well:84
Vector:pOT2
Associated Gene/TranscriptVps29-RA
Protein status:GH25884.pep: gold
Preliminary Size:1136
Sequenced Size:1003

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4764 2001-01-01 Release 2 assignment
CG4764 2001-10-10 Blastp of sequenced clone
CG4764 2003-01-01 Sim4 clustering to Release 3
CG4764 2008-04-29 Release 5.5 accounting
CG4764 2008-08-15 Release 5.9 accounting
CG4764 2008-12-18 5.12 accounting

Clone Sequence Records

GH25884.complete Sequence

1003 bp (1003 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060789

> GH25884.complete
ATCGCAGCCACCTATCGTTTAATTCGCTGGGCGTTTCACAATTTTTTTGG
GAAACACAACAAAGCTTCACAAAGGACACGATGCTCGTTCTGGTACTCGG
CGACCTGCACATCCCGCACCGGTGCAGCAGCCTGCCGGCTAAATTTAAGA
AGCTGCTGGTGCCGGGCCGCATACATCACATCCTGGCCACCGGAAACATC
TGCACCAAGGAGTCCTACGACTACCTGAAGTCCCTGGCCAATGATGTGCA
CATAGTGCGCGGCGACTTCGACGAGAACCTGACGTATCCGGAGCAGAAGG
TGGTCACGGTAGGCCAGTTCCGGATCGGTCTGTGCCACGGCCACCAGGTG
GTTCCCCGCGGAGACCCGGAGGCGCTGGCCCTCATCCAGCGGCAACTGGA
CGTGGACATCCTGATCACGGGGCACACGTACAAGTTCGAGGCCTACGAGC
ACGGCAACAAATTCTACATCAATCCGGGATCGGCCACGGGTGCCTTCAAC
CCACTGGACACCAATGTGGTGCCTTCGTTCGTGCTGATGGACATTCAGAG
CACCACGGTGGTCACGTACGTGTACCAACTGATCGGCGACGAGGTCAAAG
TGGAGCGCATCGAGTACAAGAAGATCTAGGGTCCTAGTATTAGCCACCAG
CCATTCCCCTCCAATCCAACCCTTGACCCCTGCATTCTGAGCTCGGCTTC
ATTAAAGAAATTGTAAATGTACGTAGCAATAAATCAAGTTCTCATTTTTT
TATCTGATAAAAAATGCTAGCACCTTGTTTAAATAGAGAATAAAAGTACG
AACGGACGAAAGTGAAGTTTTAGATTTAATGCAATAATAAACGATTACAA
AGTAAGGAAAAACACCCCCAGAAATTGTGATACTCCCACAATAATCTGAT
AAAAAAGTTTAAATTTTATTAAATAGAATATAAAAAGGAGTTACATCTGA
TGATCGAGTAAAGAGTCTGCTCAAAAGTTCGGAAAAAAAAAAAAAAAAAA
AAA

GH25884.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG4764-RA 982 CG4764-RA 1..982 1..982 4910 100 Plus
capt.a 1973 capt.a 1886..1973 983..896 440 100 Minus
capt-RA 2184 capt-RA 2097..2184 983..896 440 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1150700..1151681 1..982 4805 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:08:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:42:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1150783..1151765 1..983 4915 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1150783..1151765 1..983 4915 100 Plus
Blast to na_te.dros performed 2019-03-15 11:42:57
Subject Length Description Subject Range Query Range Score Percent Strand
HB 1653 HB DMTHB1 1653bp Derived from X01748 (g8693) (Rel. 49, Last updated, Version 3). 392..487 833..928 137 62.9 Plus

GH25884.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:44:02 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1150700..1151681 1..982 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:56:32 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
CG4764-RA 1..549 81..629 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:40:41 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
CG4764-RA 1..549 81..629 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:32:12 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
CG4764-RA 1..549 81..629 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:18:50 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
CG4764-RA 1..549 81..629 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:40:42 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
Vps29-RA 1..549 81..629 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:46:20 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
CG4764-RA 1..982 1..982 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:40:41 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
CG4764-RA 1..982 1..982 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:32:12 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
CG4764-RA 18..999 1..982 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:18:50 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
CG4764-RA 1..982 1..982 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:40:42 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
Vps29-RA 18..999 1..982 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:02 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1150783..1151764 1..982 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:02 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1150783..1151764 1..982 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:02 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1150783..1151764 1..982 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:32:12 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1150783..1151764 1..982 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:53:47 Download gff for GH25884.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1150783..1151764 1..982 100   Plus

GH25884.hyp Sequence

Translation from 2 to 628

> GH25884.hyp
RSHLSFNSLGVSQFFWETQQSFTKDTMLVLVLGDLHIPHRCSSLPAKFKK
LLVPGRIHHILATGNICTKESYDYLKSLANDVHIVRGDFDENLTYPEQKV
VTVGQFRIGLCHGHQVVPRGDPEALALIQRQLDVDILITGHTYKFEAYEH
GNKFYINPGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVYQLIGDEVKV
ERIEYKKI*

GH25884.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
Vps29-PA 182 CG4764-PA 1..182 27..208 956 100 Plus

GH25884.pep Sequence

Translation from 80 to 628

> GH25884.pep
MLVLVLGDLHIPHRCSSLPAKFKKLLVPGRIHHILATGNICTKESYDYLK
SLANDVHIVRGDFDENLTYPEQKVVTVGQFRIGLCHGHQVVPRGDPEALA
LIQRQLDVDILITGHTYKFEAYEHGNKFYINPGSATGAFNPLDTNVVPSF
VLMDIQSTTVVTYVYQLIGDEVKVERIEYKKI*

GH25884.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15167-PA 182 GF15167-PA 1..182 1..182 959 99.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24770-PA 182 GG24770-PA 1..182 1..182 961 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:12:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11176-PA 182 GH11176-PA 1..182 1..182 953 98.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Vps29-PA 182 CG4764-PA 1..182 1..182 956 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:12:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17980-PA 182 GI17980-PA 1..182 1..182 953 98.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15595-PA 182 GL15595-PA 1..182 1..182 951 98.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18414-PA 182 GA18414-PA 1..182 1..182 951 98.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16798-PA 182 GM16798-PA 1..182 1..182 961 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23074-PA 182 GD23074-PA 1..182 1..182 961 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19542-PA 182 GJ19542-PA 1..182 1..182 959 99.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24671-PA 182 GK24671-PA 1..182 1..182 955 98.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17363-PA 182 GE17363-PA 1..182 1..182 961 100 Plus