Clone GH25962 Report

Search the DGRC for GH25962

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:259
Well:62
Vector:pOT2
Associated Gene/TranscriptObp49a-RA
Protein status:GH25962.pep: gold
Preliminary Size:1482
Sequenced Size:774

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8769 2002-01-01 Sim4 clustering to Release 2
CG30052 2002-05-18 Blastp of sequenced clone
Obp49a 2008-04-29 Release 5.5 accounting
Obp49a 2008-08-15 Release 5.9 accounting
Obp49a 2008-12-18 5.12 accounting

Clone Sequence Records

GH25962.complete Sequence

774 bp (774 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118821

> GH25962.complete
CCGAACCAAAAATGCTTTCAAAATCGCAGCTATTACTGCTCGTTGTCGGG
TTCTGCCTGAATGCAGCCGTCTCGGCTGACGTGGACTGCAGCAAGCGGCC
ATCGTTTGTCAATCCCAAAACCTGTTGTCCAATGCCGGACTTCGTGACCG
CCGAGTTGAAGCAAAAGTGCATCAAGTTTGACATGACTCCGCCGCCGCCG
CCGGATGGGGAAGCAAGTGGATCCTTTGAGAGCAAGCGTCGTCATCATCA
TCCGCATCCCCCACCATGCTTCTTCTCCTGCATCTTTAACGAGACTGGAA
TCTATCAAAACCGGAAACTGGATGAGGCAAAGCTGAACGCCTACTTGCAG
GAGGTCTTCGAGGACAGTTCTGATCTGCAGACCACGGCCACCCAGGCCTT
CACCACCTGTGCAACCAAAGTCGCGGATTTCGAGGCCAATTTACCTCCTC
GTCCGGCTCCATCTCCGCCACCCGGATTCCCCATGTGTCCTCACGATGCT
GGTCACCTCATGGGCTGTGTGTTCCGCAATATGATGAAGAATTGCCCAGA
CTCAATACGGAATGATTCCCAGCAGTGCACTGACATGAAAGAGTTCTTCA
CCAAGTGCAAGCCACCTCGTGGTCCTCCTCCTTCCGCCGAAGATATGTAA
GGCACCCAAGAAAAATCCTATTTGTCTGAAAACCCGCAATGAATTTACCT
CTACCAAGCCGAACTTTTAATATCATTCAATTTAAGCCAATAAACATTTA
AAGCTCAAAAAAAAAAAAAAAAAA

GH25962.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
Obp49a-RA 837 Obp49a-RA 78..835 1..758 3790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8577322..8577811 756..267 2450 100 Minus
chr2R 21145070 chr2R 8577873..8578080 266..59 1040 100 Minus
chr2R 21145070 chr2R 8578136..8578194 59..1 295 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:08:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12690057..12690548 758..267 2460 100 Minus
2R 25286936 2R 12690610..12690817 266..59 1040 100 Minus
2R 25286936 2R 12690873..12690931 59..1 295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12691256..12691747 758..267 2460 100 Minus
2R 25260384 2R 12691809..12692016 266..59 1040 100 Minus
2R 25260384 2R 12692072..12692130 59..1 295 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:16:03 has no hits.

GH25962.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:17:18 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8577322..8577811 267..756 100 <- Minus
chr2R 8577873..8578079 60..266 100 <- Minus
chr2R 8578136..8578194 1..59 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:56:34 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
Obp49a-RA 1..639 12..650 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:45:38 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
Obp49a-RA 1..639 12..650 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:28 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
Obp49a-RA 1..639 12..650 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:37:58 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
Obp49a-RA 1..639 12..650 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:47:45 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
Obp49a-RA 1..639 12..650 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:21:02 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
Obp49a-RA 1..756 1..756 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:45:38 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
Obp49a-RA 25..780 1..756 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:28 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
Obp49a-RA 25..780 1..756 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:37:58 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
Obp49a-RA 1..756 1..756 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:47:45 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
Obp49a-RA 25..780 1..756 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:17:18 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12690059..12690548 267..756 100 <- Minus
2R 12690610..12690816 60..266 100 <- Minus
2R 12690873..12690931 1..59 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:17:18 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12690059..12690548 267..756 100 <- Minus
2R 12690610..12690816 60..266 100 <- Minus
2R 12690873..12690931 1..59 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:17:18 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12690059..12690548 267..756 100 <- Minus
2R 12690610..12690816 60..266 100 <- Minus
2R 12690873..12690931 1..59 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:28 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8577564..8578053 267..756 100 <- Minus
arm_2R 8578115..8578321 60..266 100 <- Minus
arm_2R 8578378..8578436 1..59 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:15 Download gff for GH25962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12691258..12691747 267..756 100 <- Minus
2R 12691809..12692015 60..266 100 <- Minus
2R 12692072..12692130 1..59 100   Minus

GH25962.hyp Sequence

Translation from 2 to 649

> GH25962.hyp
EPKMLSKSQLLLLVVGFCLNAAVSADVDCSKRPSFVNPKTCCPMPDFVTA
ELKQKCIKFDMTPPPPPDGEASGSFESKRRHHHPHPPPCFFSCIFNETGI
YQNRKLDEAKLNAYLQEVFEDSSDLQTTATQAFTTCATKVADFEANLPPR
PAPSPPPGFPMCPHDAGHLMGCVFRNMMKNCPDSIRNDSQQCTDMKEFFT
KCKPPRGPPPSAEDM*

GH25962.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Obp49a-PA 212 CG30052-PA 1..212 4..215 1180 100 Plus
Obp50e-PA 196 CG13939-PA 20..196 25..212 174 27.6 Plus
Obp47b-PA 199 CG13208-PA 1..195 5..202 143 24.3 Plus

GH25962.pep Sequence

Translation from 11 to 649

> GH25962.pep
MLSKSQLLLLVVGFCLNAAVSADVDCSKRPSFVNPKTCCPMPDFVTAELK
QKCIKFDMTPPPPPDGEASGSFESKRRHHHPHPPPCFFSCIFNETGIYQN
RKLDEAKLNAYLQEVFEDSSDLQTTATQAFTTCATKVADFEANLPPRPAP
SPPPGFPMCPHDAGHLMGCVFRNMMKNCPDSIRNDSQQCTDMKEFFTKCK
PPRGPPPSAEDM*

GH25962.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13098-PA 212 GF13098-PA 1..212 1..212 804 79.7 Plus
Dana\GF11352-PA 196 GF11352-PA 2..196 4..209 163 26.2 Plus
Dana\GF13502-PA 177 GF13502-PA 17..172 20..200 143 23.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22556-PA 212 GG22556-PA 1..212 1..212 898 88.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19957-PA 221 GH19957-PA 1..217 1..211 467 48.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Obp49a-PA 212 CG30052-PA 1..212 1..212 1180 100 Plus
Obp50e-PA 196 CG13939-PA 20..196 22..209 174 27.6 Plus
Obp47b-PA 199 CG13208-PA 1..195 2..199 143 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19915-PA 208 GI19915-PA 1..197 1..200 484 45.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17731-PA 213 GL17731-PA 1..207 1..207 750 76 Plus
Dper\GL10689-PA 424 GL10689-PA 256..400 22..189 159 25.6 Plus
Dper\GL11401-PA 198 GL11401-PA 11..198 10..209 147 25.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp49a-PA 213 GA24894-PA 1..207 1..207 751 76.4 Plus
Dpse\Obp50e-PA 198 GA12642-PA 11..198 10..209 147 25.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20340-PA 212 GM20340-PA 1..212 1..212 908 91 Plus
Dsec\GM20213-PA 196 GM20213-PA 10..196 8..209 148 26.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp49a-PA 212 GD25818-PA 1..212 1..212 924 92.5 Plus
Dsim\Obp50e-PA 196 GD25684-PA 10..196 8..209 148 27.2 Plus
Dsim\Obp50d-PA 173 GD11048-PA 3..170 6..199 139 23.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp49a-PA 212 GJ15082-PA 1..211 1..209 521 56.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21689-PA 216 GK21689-PA 1..216 1..212 509 57.1 Plus
Dwil\GK21836-PA 197 GK21836-PA 5..197 7..209 156 26 Plus
Dwil\GK19396-PA 179 GK19396-PA 1..179 7..208 148 23.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Obp49a-PA 212 GE13426-PA 1..212 1..212 899 90.1 Plus
Dyak\GE12314-PA 196 GE12314-PA 20..196 22..209 157 28.1 Plus
Dyak\GE14015-PA 203 GE14015-PA 1..197 1..200 153 21.8 Plus