Clone GH25976 Report

Search the DGRC for GH25976

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:259
Well:76
Vector:pOT2
Associated Gene/TranscriptCG4729-RD
Protein status:GH25976.pep: gold
Preliminary Size:1074
Sequenced Size:863

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4729 2001-01-01 Release 2 assignment
CG4729 2001-07-04 Blastp of sequenced clone
CG4729 2008-04-29 Release 5.5 accounting
CG4729 2008-08-15 Release 5.9 accounting
CG4729 2008-12-18 5.12 accounting

Clone Sequence Records

GH25976.complete Sequence

863 bp (863 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051615

> GH25976.complete
CAACCTTAATTTTTTAACTGAGTAATTTGGCGTTCTAATGATAAGTGCAT
AGAATTTAGCAAATTGCAAATTTATTATGGTTTTAAATTAAACTCGCAGA
AACCCCCGCCACAATGCTGAGTTTGCTGCATGGAAAGAGCGTGGAACCGC
ACCTGCTGATGAGGCGTATTCCACTGGAACAGGTTCCGGAGGATGAGAAG
GAGGCGGCCGCCTGGCTGCAGAACCTGTTCGTGGAGAAGGACAAGATCAT
CGATAGCTTCCTGGAGACGGGCAGCTTCTTTAAGACGTCCGGCATAAAGG
AGGTTCCGGCATATGTGAATAAACGCCGGCTGTGCTCACTCGTGAACTTT
GTCTGCTGGGCGGTATTCTCTCTGTCCTGCATTTTCTACTACGTGATCAC
ATCCCTGCTGGCGGCCAACTGGACGGCCTTTATCACCGCACTTTCCGTCC
TGGGACTTTTTTACTGGCTCATGGGTCAGGCCATCAACAAGACGCAGATC
AGCAAGGCATCTAATTATGGATCCTCCAAGTCGGTCGCAAAGTAACTTTC
GAATTCGCATTTAGTTTCGATTGTCGTCGAACTCAATTATCTACAAATGA
CTTTGTAAAAGGCAGTCCTCTCACAAATCTCTCTGCTAAATGGATCAATT
CGTGATTCCTATCCGGACGATTTAAAGTGTTTTGCATGTTTTTCTTGTCT
AAGTTTATAGTTACGAAGTAACTCCCGCACACTGGAGCCATCAATTTGCG
TACGTAGTTGGTAGTTGTACACCTAAGTGGAAATTTAATTGTTTGATCAA
TTGTATTTTGGCGAGCATTGCAATAATTAAATTAAACAGAACGTGAAAAA
AAAAAAAAAAAAA

GH25976.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG4729-RD 846 CG4729-RD 1..846 1..846 4230 100 Plus
CG4729-RC 1713 CG4729-RC 933..1677 102..846 3725 100 Plus
CG4729-RB 1681 CG4729-RB 929..1673 102..846 3725 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16371527..16371912 845..460 1900 99.5 Minus
chr3L 24539361 chr3L 16372137..16372494 459..102 1790 100 Minus
chr3L 24539361 chr3L 16372587..16372687 101..1 505 100 Minus
chr3L 24539361 chr3L 16369174..16369307 304..171 325 82.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:08:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16381771..16382157 846..460 1935 100 Minus
3L 28110227 3L 16382382..16382739 459..102 1790 100 Minus
3L 28110227 3L 16382832..16382932 101..1 505 100 Minus
3L 28110227 3L 16379425..16379558 304..171 325 82.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16374871..16375257 846..460 1935 100 Minus
3L 28103327 3L 16375482..16375839 459..102 1790 100 Minus
3L 28103327 3L 16375932..16376032 101..1 505 100 Minus
3L 28103327 3L 16372525..16372658 304..171 325 82.8 Minus
Blast to na_te.dros performed 2019-03-15 23:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
Juan 4236 Juan JUAN 4236bp 2617..2761 824..688 111 58.2 Minus

GH25976.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:50:10 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16371527..16371912 460..845 99 <- Minus
chr3L 16372137..16372494 102..459 100 <- Minus
chr3L 16372587..16372687 1..101 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:56:37 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
CG4729-RB 718..1161 102..545 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:23:42 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
CG4729-RB 718..1161 102..545 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:44 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
CG4729-RC 718..1161 102..545 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:56:31 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
CG4729-RB 718..1161 102..545 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:49:34 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
CG4729-RC 718..1161 102..545 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:21:29 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
CG4729-RD 1..845 1..845 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:23:42 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
CG4729-RD 1..845 1..845 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:44 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
CG4729-RD 1..845 1..845 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:56:31 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
CG4729-RD 1..845 1..845 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:49:34 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
CG4729-RD 1..845 1..845 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:50:10 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16382382..16382739 102..459 100 <- Minus
3L 16382832..16382932 1..101 100   Minus
3L 16381772..16382157 460..845 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:50:10 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16382382..16382739 102..459 100 <- Minus
3L 16382832..16382932 1..101 100   Minus
3L 16381772..16382157 460..845 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:50:10 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16382382..16382739 102..459 100 <- Minus
3L 16382832..16382932 1..101 100   Minus
3L 16381772..16382157 460..845 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:44 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16374872..16375257 460..845 100 <- Minus
arm_3L 16375482..16375839 102..459 100 <- Minus
arm_3L 16375932..16376032 1..101 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:34:14 Download gff for GH25976.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16374872..16375257 460..845 100 <- Minus
3L 16375482..16375839 102..459 100 <- Minus
3L 16375932..16376032 1..101 100   Minus

GH25976.pep Sequence

Translation from 113 to 544

> GH25976.pep
MLSLLHGKSVEPHLLMRRIPLEQVPEDEKEAAAWLQNLFVEKDKIIDSFL
ETGSFFKTSGIKEVPAYVNKRRLCSLVNFVCWAVFSLSCIFYYVITSLLA
ANWTAFITALSVLGLFYWLMGQAINKTQISKASNYGSSKSVAK*

GH25976.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10214-PA 386 GF10214-PA 244..386 1..143 666 87.4 Plus
Dana\GF10215-PA 379 GF10215-PA 239..376 1..138 439 58.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13455-PA 387 GG13455-PA 244..382 1..139 726 98.6 Plus
Dere\GG13456-PA 379 GG13456-PA 239..376 1..138 460 60.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15594-PA 387 GH15594-PA 244..380 1..137 542 73.7 Plus
Dgri\GH15593-PA 383 GH15593-PA 243..380 3..140 408 57.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
Agpat3-PD 143 CG4729-PD 1..143 1..143 734 100 Plus
Agpat3-PB 386 CG4729-PB 244..386 1..143 734 100 Plus
Agpat3-PC 386 CG4729-PC 244..386 1..143 734 100 Plus
Agpat3-PA 386 CG4729-PA 244..386 1..143 734 100 Plus
Agpat3-PE 397 CG4729-PE 255..397 1..143 734 100 Plus
Agpat4-PC 380 CG4753-PC 239..376 1..138 451 60.9 Plus
Agpat4-PA 380 CG4753-PA 239..376 1..138 451 60.9 Plus
Agpat4-PB 380 CG4753-PB 239..376 1..138 451 60.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16871-PA 388 GI16871-PA 244..381 1..138 553 75.4 Plus
Dmoj\GI16870-PA 387 GI16870-PA 245..385 3..143 330 51.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17998-PA 389 GL17998-PA 244..383 1..140 616 82.1 Plus
Dper\GL17999-PA 383 GL17999-PA 239..383 1..143 478 60 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18389-PA 389 GA18389-PA 244..383 1..140 616 82.1 Plus
Dpse\GA18406-PA 383 GA18406-PA 239..383 1..143 478 60 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24405-PA 386 GM24405-PA 244..386 1..143 738 97.9 Plus
Dsec\GM24407-PA 378 GM24407-PA 239..377 1..139 459 60.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12474-PA 386 GD12474-PA 244..386 1..143 744 98.6 Plus
Dsim\GD12475-PA 380 GD12475-PA 239..367 1..129 424 59.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12621-PA 388 GJ12621-PA 244..383 1..140 539 73.6 Plus
Dvir\GJ12620-PA 337 GJ12620-PA 195..335 3..143 415 54.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20785-PA 395 GK20785-PA 244..386 1..142 581 79 Plus
Dwil\GK20796-PA 382 GK20796-PA 239..378 1..140 484 63.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22556-PA 387 GE22556-PA 244..383 1..140 730 98.6 Plus
Dyak\GE22903-PA 387 GE22903-PA 244..383 1..140 730 98.6 Plus
Dyak\GE22904-PA 379 GE22904-PA 239..376 1..138 454 60.1 Plus
Dyak\GE22557-PA 379 GE22557-PA 239..376 1..138 454 60.1 Plus

GH25976.hyp Sequence

Translation from 113 to 544

> GH25976.hyp
MLSLLHGKSVEPHLLMRRIPLEQVPEDEKEAAAWLQNLFVEKDKIIDSFL
ETGSFFKTSGIKEVPAYVNKRRLCSLVNFVCWAVFSLSCIFYYVITSLLA
ANWTAFITALSVLGLFYWLMGQAINKTQISKASNYGSSKSVAK*

GH25976.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG4729-PD 143 CG4729-PD 1..143 1..143 734 100 Plus
CG4729-PB 386 CG4729-PB 244..386 1..143 734 100 Plus
CG4729-PC 386 CG4729-PC 244..386 1..143 734 100 Plus
CG4729-PA 386 CG4729-PA 244..386 1..143 734 100 Plus
CG4729-PE 397 CG4729-PE 255..397 1..143 734 100 Plus