Clone GH26058 Report

Search the DGRC for GH26058

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:260
Well:58
Vector:pOT2
Associated Gene/TranscriptCG10934-RA
Protein status:GH26058.pep: gold
Preliminary Size:1272
Sequenced Size:1063

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10934 2001-01-01 Release 2 assignment
CG10934 2001-11-29 Blastp of sequenced clone
CG10934 2008-04-29 Release 5.5 accounting
CG10934 2008-08-15 Release 5.9 accounting
CG10934 2008-12-18 5.12 accounting

Clone Sequence Records

GH26058.complete Sequence

1063 bp (1063 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069205

> GH26058.complete
TAACACCTTCCAAACACAATTCATAGCGCCTGGAGCTAACTCAAATCTAT
CATTCGTTCACATTTTGTATACGACTAAAATGGTGGTTGTACAGGGAATG
TACGAAGTCACGGAGCTGGTGGCTGGCAGCGTGGGATGCGTGTGTCTATA
CATCGCCGGATGCAATGTGCTGCCCATGGAGCATATTCCCGATCTTCCGT
CGGCGCTGTTCGTCCTGACCGCCGTGCTTTTTCTCCATCATCTGAGGGTA
ATGAATTGCGCACCGCTGCAGAAGCTTTGGCTTTTGCTGCTGGAACTGTT
GGTCTTCTATATGTGCACCCAGGTCGTGGTGCTTGTGTGGCTCCAGTTGC
TCAGCCATATGAATAAACTGCGGGACAATGCAGTTAATACTCGTACCGGC
ATGTACCTTTTTGAAGCCTATCCAAAAGTCTTTATGTTTTTGCGCCAAGA
TGTCTACTATTTGGGGCAGCTTATCATGTCCGTGGCGTGCACCTACAAGG
CGATAATGGTCACTCATGCCCTGGACTACGCCCTACCAAATCGCCGGACG
TACAGATACTATGAGACAGATGAGAACTTAGGCGATGGTCCGCGGCGTCC
TACCCGAAAGAGCAACCAGCGATCAACACCCAAGAAGAGCACCGTGCGTG
GTCGCAAAAAATAGAAGCTGTCGCAGAAACTGGATCAATCAAATCGCCCA
ATCTAAACACAGTTTTTCTATGCTTTCGATCATTGAATTAGCCCACAAAA
CACGCGTAATAAATTATCAAGGTAAACGGCGGCCCGGGTGCATTGCACCC
AAATCGAAGGTGCTGCTCAAGAGCAGTTTACGCTTTACTAGAAATTTGCA
TGCTTGAAAGAGCAGAGCCAACACGTACACACAAAACCAACTTATTTTCA
AATTTTGGCGCCTCGCGACAATCGATTAACGGACAACATCATCAAGATCA
GCCAATCGTATGAATTCCACCTCTAACACCAGAGAATATTGAGAAGAAGA
AGAGCGTTGTGTCGGATCTAAACAATAAAGAAATTAAGCAATTAAAAAAA
AAAAAAAAAAAAA

GH26058.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG10934-RA 1043 CG10934-RA 1..1043 1..1043 5215 100 Plus
CG10933-RA 1398 CG10933-RA 1..70 975..1044 350 100 Plus
CG10933.a 1447 CG10933.a 1..70 975..1044 350 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13609479..13610521 1..1043 5170 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:08:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17722339..17723382 1..1044 5220 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17723538..17724581 1..1044 5220 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:51:07 has no hits.

GH26058.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:52:20 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13609479..13610521 1..1043 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:56:46 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
CG10934-RA 1..585 80..664 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:22:42 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
CG10934-RA 1..585 80..664 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:23:34 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
CG10934-RA 1..585 80..664 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:49:04 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
CG10934-RA 1..585 80..664 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:19:39 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
CG10934-RA 1..585 80..664 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:57:29 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
CG10934-RA 1..1043 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:22:41 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
CG10934-RA 1..1043 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:23:34 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
CG10934-RA 1..1043 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:49:05 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
CG10934-RA 1..1043 1..1043 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:19:39 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
CG10934-RA 1..1043 1..1043 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:52:20 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17722339..17723381 1..1043 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:52:20 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17722339..17723381 1..1043 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:52:20 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17722339..17723381 1..1043 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:23:34 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13609844..13610886 1..1043 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:25:39 Download gff for GH26058.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17723538..17724580 1..1043 100   Plus

GH26058.hyp Sequence

Translation from 0 to 663

> GH26058.hyp
NTFQTQFIAPGANSNLSFVHILYTTKMVVVQGMYEVTELVAGSVGCVCLY
IAGCNVLPMEHIPDLPSALFVLTAVLFLHHLRVMNCAPLQKLWLLLLELL
VFYMCTQVVVLVWLQLLSHMNKLRDNAVNTRTGMYLFEAYPKVFMFLRQD
VYYLGQLIMSVACTYKAIMVTHALDYALPNRRTYRYYETDENLGDGPRRP
TRKSNQRSTPKKSTVRGRKK*

GH26058.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG10934-PA 194 CG10934-PA 1..194 27..220 1019 100 Plus

GH26058.pep Sequence

Translation from 79 to 663

> GH26058.pep
MVVVQGMYEVTELVAGSVGCVCLYIAGCNVLPMEHIPDLPSALFVLTAVL
FLHHLRVMNCAPLQKLWLLLLELLVFYMCTQVVVLVWLQLLSHMNKLRDN
AVNTRTGMYLFEAYPKVFMFLRQDVYYLGQLIMSVACTYKAIMVTHALDY
ALPNRRTYRYYETDENLGDGPRRPTRKSNQRSTPKKSTVRGRKK*

GH26058.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11664-PA 212 GF11664-PA 1..185 1..181 431 46.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21811-PA 197 GG21811-PA 1..196 1..193 739 73 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG10934-PA 194 CG10934-PA 1..194 1..194 1019 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21813-PA 197 GM21813-PA 1..197 1..194 857 82.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11304-PA 197 GD11304-PA 1..197 1..194 856 81.7 Plus
Dsim\GD15436-PA 195 GD15436-PA 1..192 1..189 706 71.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18131-PA 512 GK18131-PA 305..458 9..161 212 30.5 Plus
Dwil\GK18206-PA 193 GK18206-PA 1..157 1..156 203 31.8 Plus
Dwil\GK15037-PA 187 GK15037-PA 1..185 1..187 182 22.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11888-PA 197 GE11888-PA 1..196 1..193 697 73.5 Plus