Clone GH26094 Report

Search the DGRC for GH26094

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:260
Well:94
Vector:pOT2
Associated Gene/TranscriptCG17470-RA
Protein status:GH26094.pep: gold
Preliminary Size:1075
Sequenced Size:959

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17470 2001-01-01 Release 2 assignment
CG17470 2001-10-10 Blastp of sequenced clone
CG17470 2003-01-01 Sim4 clustering to Release 3
CG17470 2008-04-29 Release 5.5 accounting
CG17470 2008-08-15 Release 5.9 accounting
CG17470 2008-12-18 5.12 accounting

Clone Sequence Records

GH26094.complete Sequence

959 bp (959 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060794

> GH26094.complete
GGAATTTTAGTCATATCTAAAATTTCGGCAACATAAGACCTTCCAATTTT
TGTTTGTAAATAAGAACGTTTTTTAAATTTAACTTCGGTTTTTGTTCTGT
TGGGTAGTTAGTTTCCGCACTCGAAACACCGACAAAAACCATGTTTCGCA
ATCTTTCGATGCTGAGGAATCAGCTGGCGCTGCACCGTGTCCGTGTGGCC
CGCTCGACCTTGCACTCCAAAATGTCTACTGGTCTTACTTGCCTCACCAT
TGACCGTCCGCGGAACATCGATGGCGTGACCGTGATAGATATCAATATAA
ATGAGATGGCCAAGACTGACGTAGAGTTTAATCGCAATTTCGTCAATTCG
CTGACATTGATGGACCATACTCCATTCAAAGAGGTGACCAACATAGTGGA
CGCGGATGCAGTTGAGTCGCCACCAGCAGAGAATCCGATTTCTGGAGATA
CCGTGGAGATCCTGCCTACTGGCGCACCTAGTTCCGTCGTAGGCGTCGAC
GGCAACCCCATTGTCCCCATCGAGATTGATGGCTGGAACCAGGACGAGGA
GGATCCCACCGTGCAAAAGAACGTCCAGGACGTGGACATTGGTAACGATG
ACGAGTACAAGGCCGAGATGGAGCTGCGGGTGCCGGAGGTCAGGGAAGGT
CGAACCGAGTACAAGGGCATCAAGGTGACGTTGCCGGAATCGGCCAACCA
GGATGTCGGCACTTATCGCTTCCGCCGCGATCCAAAGGATCTGGAGGAGG
TCGGCGACGACACGCGCCTGGTTCGATACGACAAGTAGAAAAACTGGTTC
CAAAATTCTTAAGGATTTTTTTGGACGACTTCCGCTTGCGACTATTCCAA
TTTTTTAGCGTATTCAATAGGTTTTCGGTAAAAGGAAGCACTAGCATTGA
TGTAATAAAAAAAAACATATTTATATGTTCAGTTAATAGAAAAAAAAAAA
AAAAAAAAA

GH26094.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG17470-RA 939 CG17470-RA 1..939 1..939 4695 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20640752..20641690 939..1 4665 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:08:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20642303..20643244 942..1 4710 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20642303..20643244 942..1 4710 100 Minus
Blast to na_te.dros performed 2019-03-16 13:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 973..1069 130..34 116 57.7 Minus

GH26094.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:33:01 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20640752..20641690 1..939 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:56:52 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
CG17470-RA 1..648 141..788 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:40 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
CG17470-RA 1..648 141..788 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:41:37 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
CG17470-RA 1..648 141..788 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:14:15 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
CG17470-RA 1..648 141..788 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:42 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
CG17470-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:40 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
CG17470-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:41:37 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
CG17470-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:48 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
CG17470-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:14:15 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
CG17470-RA 1..939 1..939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:01 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20642306..20643244 1..939 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:01 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20642306..20643244 1..939 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:01 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20642306..20643244 1..939 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:41:37 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20642306..20643244 1..939 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:03:00 Download gff for GH26094.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20642306..20643244 1..939 100   Minus

GH26094.hyp Sequence

Translation from 140 to 787

> GH26094.hyp
MFRNLSMLRNQLALHRVRVARSTLHSKMSTGLTCLTIDRPRNIDGVTVID
ININEMAKTDVEFNRNFVNSLTLMDHTPFKEVTNIVDADAVESPPAENPI
SGDTVEILPTGAPSSVVGVDGNPIVPIEIDGWNQDEEDPTVQKNVQDVDI
GNDDEYKAEMELRVPEVREGRTEYKGIKVTLPESANQDVGTYRFRRDPKD
LEEVGDDTRLVRYDK*

GH26094.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG17470-PA 215 CG17470-PA 1..215 1..215 1113 100 Plus

GH26094.pep Sequence

Translation from 140 to 787

> GH26094.pep
MFRNLSMLRNQLALHRVRVARSTLHSKMSTGLTCLTIDRPRNIDGVTVID
ININEMAKTDVEFNRNFVNSLTLMDHTPFKEVTNIVDADAVESPPAENPI
SGDTVEILPTGAPSSVVGVDGNPIVPIEIDGWNQDEEDPTVQKNVQDVDI
GNDDEYKAEMELRVPEVREGRTEYKGIKVTLPESANQDVGTYRFRRDPKD
LEEVGDDTRLVRYDK*

GH26094.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14558-PA 218 GF14558-PA 1..217 1..215 630 59.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21563-PA 215 GG21563-PA 1..215 1..215 951 85.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10855-PA 224 GH10855-PA 1..222 1..214 427 43.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG17470-PA 215 CG17470-PA 1..215 1..215 1113 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19675-PA 171 GI19675-PA 1..170 56..215 393 51.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19604-PA 586 GL19604-PA 391..585 4..215 396 43.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26025-PA 686 GA26025-PA 487..685 4..215 401 43.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23320-PA 212 GM23320-PA 1..212 1..215 1037 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21693-PA 212 GD21693-PA 1..212 1..215 1027 93.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17432-PA 217 GJ17432-PA 1..216 1..215 469 49.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15047-PA 218 GK15047-PA 1..217 1..215 481 47.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12584-PA 215 GE12584-PA 1..215 1..215 955 85.6 Plus