BDGP Sequence Production Resources |
Search the DGRC for GH26102
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 261 |
Well: | 2 |
Vector: | pOT2 |
Associated Gene/Transcript | CG32441-RD |
Protein status: | GH26102.pep: validated not full length |
Sequenced Size: | 781 |
Gene | Date | Evidence |
---|---|---|
CG32441 | 2008-04-29 | Release 5.5 accounting |
CG32441 | 2008-04-29 | Picked prior to 5.5 |
CG32441 | 2008-08-15 | Release 5.9 accounting |
CG32441 | 2008-12-18 | 5.12 accounting |
781 bp assembled on 2007-07-18
GenBank Submission: BT030820
> GH26102.complete TTCGACGTTCATGTGAAGATTAGAAAAATACAGACAAATATATTTCATAG TTCAAAAAAAGTTTTTAATGTCTATTTTAACAACTTTTGAGTACTCCAGA TAGAGAAGCGCACAGATATTTAATATGATTGCAACGAACAGAATGGGATT CCTGGAGCATGACAGCTGGATTACAGTGGAGCTCCAGCACTCGCTGGCTG CAAACTCGGAAAGTTTCTCCTTCCGCGGGAATGTGACGATTCCCAGTCTC AACTCTGGTCTGGCCAATGTGGAGCAACCAGATCTGAGCACTGCCGATCT GGACTTGCTGAAGAAACTGGCCCTTGGAAACGAGTTCTACCGTTTGAAGG CCACGGTGGTGTATTCAAATGGAGCTAAGGCGCAGTTCATCACTTCCAAC AAGGCCTGTCGCCTGCTGCAAGCCCAATTGAATGACGTGCTTTGGGTGTC GCTCGAACCCTCCGGATACGTAACCGGCATCACTGTGTCCCAGGACACGG CCCCGGCCACTATAGAGTGCACCCAGGAAGACGTGAATAAGCTACTGGAA ACGCAATTCAGCACCGATGTCCTCATCCGCCACGCTGAACTGGCCCCCGT GCCCGATACTGCTGGCTTTATTCAGAAGGTGGAGCGGGAGCGCGAGGCCA GGGAGCGCGGGGAGGTTCGGGATAACCGCGGCTTCTTTGCCAAATACTGG ATGTACATCGTTCCGGTAGTTCTGTTGGTCTTCATTTCGGGAGCCACCAA CCAGGACGGTGCAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 21564161..21564546 | 312..697 | 1915 | 99.7 | Plus |
chr3L | 24539361 | chr3L | 21563679..21563847 | 145..313 | 845 | 100 | Plus |
chr3L | 24539361 | chr3L | 21563067..21563212 | 1..146 | 730 | 100 | Plus |
chr3L | 24539361 | chr3L | 21564606..21564670 | 698..762 | 325 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 21575225..21575610 | 312..697 | 1930 | 100 | Plus |
3L | 28110227 | 3L | 21574743..21574911 | 145..313 | 845 | 100 | Plus |
3L | 28110227 | 3L | 21574131..21574276 | 1..146 | 730 | 100 | Plus |
3L | 28110227 | 3L | 21575670..21575738 | 698..766 | 345 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 21568325..21568710 | 312..697 | 1930 | 100 | Plus |
3L | 28103327 | 3L | 21567843..21568011 | 145..313 | 845 | 100 | Plus |
3L | 28103327 | 3L | 21567231..21567376 | 1..146 | 730 | 100 | Plus |
3L | 28103327 | 3L | 21568770..21568838 | 698..766 | 345 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21563067..21563211 | 1..145 | 100 | -> | Plus |
chr3L | 21563680..21563847 | 146..313 | 100 | -> | Plus |
chr3L | 21564163..21564546 | 314..697 | 99 | -> | Plus |
chr3L | 21564606..21564670 | 698..762 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RD | 1..638 | 125..762 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RD | 1..638 | 125..762 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RD | 1..645 | 125..769 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RB | 1..582 | 125..707 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RD | 1..645 | 125..769 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RD | 1..762 | 1..762 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RD | 1..762 | 1..762 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RD | 1..762 | 1..762 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RB | 1..706 | 1..707 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RD | 1..762 | 1..762 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21574131..21574275 | 1..145 | 100 | -> | Plus |
3L | 21574744..21574911 | 146..313 | 100 | -> | Plus |
3L | 21575227..21575610 | 314..697 | 100 | -> | Plus |
3L | 21575670..21575734 | 698..762 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21574131..21574275 | 1..145 | 100 | -> | Plus |
3L | 21574744..21574911 | 146..313 | 100 | -> | Plus |
3L | 21575227..21575610 | 314..697 | 100 | -> | Plus |
3L | 21575670..21575734 | 698..762 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21574131..21574275 | 1..145 | 100 | -> | Plus |
3L | 21574744..21574911 | 146..313 | 100 | -> | Plus |
3L | 21575227..21575610 | 314..697 | 100 | -> | Plus |
3L | 21575670..21575734 | 698..762 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21567844..21568011 | 146..313 | 100 | -> | Plus |
arm_3L | 21567231..21567375 | 1..145 | 100 | -> | Plus |
arm_3L | 21568770..21568834 | 698..762 | 100 | Plus | |
arm_3L | 21568327..21568710 | 314..697 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21568327..21568710 | 314..697 | 100 | -> | Plus |
3L | 21568770..21568834 | 698..762 | 100 | Plus | |
3L | 21567231..21567375 | 1..145 | 100 | -> | Plus |
3L | 21567844..21568011 | 146..313 | 100 | -> | Plus |
Translation from 124 to 781
> GH26102.pep MIATNRMGFLEHDSWITVELQHSLAANSESFSFRGNVTIPSLNSGLANVE QPDLSTADLDLLKKLALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQA QLNDVLWVSLEPSGYVTGITVSQDTAPATIECTQEDVNKLLETQFSTDVL IRHAELAPVPDTAGFIQKVEREREARERGEVRDNRGFFAKYWMYIVPVVL LVFISGATNQDGAKKKKKK
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23728-PA | 227 | GF23728-PA | 21..227 | 8..214 | 858 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16204-PA | 227 | GG16204-PA | 21..227 | 8..214 | 1074 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14182-PA | 224 | GH14182-PA | 17..224 | 8..214 | 692 | 67.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32441-PD | 214 | CG32441-PD | 1..214 | 1..214 | 1088 | 100 | Plus |
CG32441-PC | 227 | CG32441-PC | 15..227 | 2..214 | 1056 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22092-PA | 228 | GI22092-PA | 22..228 | 9..214 | 675 | 68.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18105-PA | 224 | GL18105-PA | 12..224 | 2..214 | 910 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16906-PA | 224 | GA16906-PA | 12..224 | 2..214 | 910 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22386-PA | 218 | GM22386-PA | 22..211 | 2..191 | 826 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17649-PA | 211 | GD17649-PA | 15..204 | 2..191 | 830 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24207-PA | 228 | GJ24207-PA | 15..228 | 1..214 | 709 | 67.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18047-PA | 227 | GK18047-PA | 22..227 | 9..214 | 763 | 73.8 | Plus |
Translation from 124 to 760
> GH26102.hyp MIATNRMGFLEHDSWITVELQHSLAANSESFSFRGNVTIPSLNSGLANVE QPDLSTADLDLLKKLALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQA QLNDVLWVSLEPSGYVTGITVSQDTAPATIECTQEDVNKLLETQFSTDVL IRHAELAPVPDTAGFIQKVEREREARERGEVRDNRGFFAKYWMYIVPVVL LVFISGATNQDG