Clone GH26102 Report

Search the DGRC for GH26102

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:261
Well:2
Vector:pOT2
Associated Gene/TranscriptCG32441-RD
Protein status:GH26102.pep: validated not full length
Sequenced Size:781

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32441 2008-04-29 Release 5.5 accounting
CG32441 2008-04-29 Picked prior to 5.5
CG32441 2008-08-15 Release 5.9 accounting
CG32441 2008-12-18 5.12 accounting

Clone Sequence Records

GH26102.complete Sequence

781 bp assembled on 2007-07-18

GenBank Submission: BT030820

> GH26102.complete
TTCGACGTTCATGTGAAGATTAGAAAAATACAGACAAATATATTTCATAG
TTCAAAAAAAGTTTTTAATGTCTATTTTAACAACTTTTGAGTACTCCAGA
TAGAGAAGCGCACAGATATTTAATATGATTGCAACGAACAGAATGGGATT
CCTGGAGCATGACAGCTGGATTACAGTGGAGCTCCAGCACTCGCTGGCTG
CAAACTCGGAAAGTTTCTCCTTCCGCGGGAATGTGACGATTCCCAGTCTC
AACTCTGGTCTGGCCAATGTGGAGCAACCAGATCTGAGCACTGCCGATCT
GGACTTGCTGAAGAAACTGGCCCTTGGAAACGAGTTCTACCGTTTGAAGG
CCACGGTGGTGTATTCAAATGGAGCTAAGGCGCAGTTCATCACTTCCAAC
AAGGCCTGTCGCCTGCTGCAAGCCCAATTGAATGACGTGCTTTGGGTGTC
GCTCGAACCCTCCGGATACGTAACCGGCATCACTGTGTCCCAGGACACGG
CCCCGGCCACTATAGAGTGCACCCAGGAAGACGTGAATAAGCTACTGGAA
ACGCAATTCAGCACCGATGTCCTCATCCGCCACGCTGAACTGGCCCCCGT
GCCCGATACTGCTGGCTTTATTCAGAAGGTGGAGCGGGAGCGCGAGGCCA
GGGAGCGCGGGGAGGTTCGGGATAACCGCGGCTTCTTTGCCAAATACTGG
ATGTACATCGTTCCGGTAGTTCTGTTGGTCTTCATTTCGGGAGCCACCAA
CCAGGACGGTGCAAAAAAAAAAAAAAAAAAA

GH26102.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG32441-RD 1077 CG32441-RD 1..766 1..766 3830 100 Plus
CG32441-RC 1186 CG32441-RC 254..875 145..766 3110 100 Plus
CG32441.a 1473 CG32441.a 254..875 145..766 3110 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21564161..21564546 312..697 1915 99.7 Plus
chr3L 24539361 chr3L 21563679..21563847 145..313 845 100 Plus
chr3L 24539361 chr3L 21563067..21563212 1..146 730 100 Plus
chr3L 24539361 chr3L 21564606..21564670 698..762 325 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:08:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21575225..21575610 312..697 1930 100 Plus
3L 28110227 3L 21574743..21574911 145..313 845 100 Plus
3L 28110227 3L 21574131..21574276 1..146 730 100 Plus
3L 28110227 3L 21575670..21575738 698..766 345 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21568325..21568710 312..697 1930 100 Plus
3L 28103327 3L 21567843..21568011 145..313 845 100 Plus
3L 28103327 3L 21567231..21567376 1..146 730 100 Plus
3L 28103327 3L 21568770..21568838 698..766 345 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:05:22 has no hits.

GH26102.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:06:04 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21563067..21563211 1..145 100 -> Plus
chr3L 21563680..21563847 146..313 100 -> Plus
chr3L 21564163..21564546 314..697 99 -> Plus
chr3L 21564606..21564670 698..762 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:56:54 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RD 1..638 125..762 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:26:19 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RD 1..638 125..762 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:02:10 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RD 1..645 125..769 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:11:59 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RB 1..582 125..707 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:22:46 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RD 1..645 125..769 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:32:03 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RD 1..762 1..762 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:26:18 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RD 1..762 1..762 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:02:10 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RD 1..762 1..762 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:11:59 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RB 1..706 1..707 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:22:46 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RD 1..762 1..762 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:06:04 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21574131..21574275 1..145 100 -> Plus
3L 21574744..21574911 146..313 100 -> Plus
3L 21575227..21575610 314..697 100 -> Plus
3L 21575670..21575734 698..762 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:06:04 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21574131..21574275 1..145 100 -> Plus
3L 21574744..21574911 146..313 100 -> Plus
3L 21575227..21575610 314..697 100 -> Plus
3L 21575670..21575734 698..762 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:06:04 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21574131..21574275 1..145 100 -> Plus
3L 21574744..21574911 146..313 100 -> Plus
3L 21575227..21575610 314..697 100 -> Plus
3L 21575670..21575734 698..762 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:02:10 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21567844..21568011 146..313 100 -> Plus
arm_3L 21567231..21567375 1..145 100 -> Plus
arm_3L 21568770..21568834 698..762 100   Plus
arm_3L 21568327..21568710 314..697 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:58:34 Download gff for GH26102.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21568327..21568710 314..697 100 -> Plus
3L 21568770..21568834 698..762 100   Plus
3L 21567231..21567375 1..145 100 -> Plus
3L 21567844..21568011 146..313 100 -> Plus

GH26102.pep Sequence

Translation from 124 to 781

> GH26102.pep
MIATNRMGFLEHDSWITVELQHSLAANSESFSFRGNVTIPSLNSGLANVE
QPDLSTADLDLLKKLALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQA
QLNDVLWVSLEPSGYVTGITVSQDTAPATIECTQEDVNKLLETQFSTDVL
IRHAELAPVPDTAGFIQKVEREREARERGEVRDNRGFFAKYWMYIVPVVL
LVFISGATNQDGAKKKKKK

GH26102.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23728-PA 227 GF23728-PA 21..227 8..214 858 84.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16204-PA 227 GG16204-PA 21..227 8..214 1074 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14182-PA 224 GH14182-PA 17..224 8..214 692 67.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG32441-PD 214 CG32441-PD 1..214 1..214 1088 100 Plus
CG32441-PC 227 CG32441-PC 15..227 2..214 1056 97.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22092-PA 228 GI22092-PA 22..228 9..214 675 68.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18105-PA 224 GL18105-PA 12..224 2..214 910 78.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16906-PA 224 GA16906-PA 12..224 2..214 910 78.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22386-PA 218 GM22386-PA 22..211 2..191 826 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17649-PA 211 GD17649-PA 15..204 2..191 830 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24207-PA 228 GJ24207-PA 15..228 1..214 709 67.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18047-PA 227 GK18047-PA 22..227 9..214 763 73.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23269-PA 227 GE23269-PA 15..227 2..214 933 93.9 Plus
Dyak\GE19774-PA 227 GE19774-PA 15..227 2..214 933 93.9 Plus

GH26102.hyp Sequence

Translation from 124 to 760

> GH26102.hyp
MIATNRMGFLEHDSWITVELQHSLAANSESFSFRGNVTIPSLNSGLANVE
QPDLSTADLDLLKKLALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQA
QLNDVLWVSLEPSGYVTGITVSQDTAPATIECTQEDVNKLLETQFSTDVL
IRHAELAPVPDTAGFIQKVEREREARERGEVRDNRGFFAKYWMYIVPVVL
LVFISGATNQDG

GH26102.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG32441-PD 214 CG32441-PD 1..212 1..212 1079 100 Plus
CG32441-PC 227 CG32441-PC 15..225 2..212 1047 97.2 Plus