Clone GH26134 Report

Search the DGRC for GH26134

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:261
Well:34
Vector:pOT2
Associated Gene/TranscriptCG5398-RA
Protein status:GH26134.pep: gold
Preliminary Size:1136
Sequenced Size:920

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5398 2001-01-01 Release 2 assignment
CG5398 2002-01-03 Blastp of sequenced clone
CG5398 2003-01-01 Sim4 clustering to Release 3
CG5398 2008-04-29 Release 5.5 accounting
CG5398 2008-08-15 Release 5.9 accounting
CG5398 2008-12-18 5.12 accounting

Clone Sequence Records

GH26134.complete Sequence

920 bp (920 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075351

> GH26134.complete
AATACTCAGACATACATAGTTAGTCAGTGATCATTTAGTTAGTTAGTTTT
TTCCTTAAATTGTCTGTGATACATTACATATTACGGATAATTCACGATGA
TCTGGGACTTCTTTACCTTTATACGCGGAGCCACCGAGTTCAGTGCCACT
GCGCTACTGATTTTGCTCGGTTGCATGGGAGACTCAACGAACCAAGGTGG
TGAGAGCAAATTCTTGGTGGCCAGCGTTCACTATGGCCTGACGGTGATGG
TGGTGATGCACGTGTTTGGCTTCGTATCCGGAGCCCATTCGAATCCATGC
ATCTCGATCTCATGCTACTTGATGGGCTACATCGCCCTGGAAGTGATGAT
GATGTACGTGGTGTGTCAGATGGCCGGTGCTTTCCTTGGTTACTTCCTGC
TAATGCAACTGCTGCCCAAGGAGCTGGTGGACAAAAGCAAGCCAGGCATT
TGCCTGGTACAACCGATGGACACTCTGTCCACATACCAGGTCGTCATCAT
CGAGTGCCTGCTGACCGCGGTCCTCGTGCTCGGATGGTGCTCCTTGTGGG
ACGTGCGAAACGGAAGGTTCCTCGACTCGGTCGCCATTCGCATGGGTCTC
CTCGTGATCGCTTGCAGTTTCGCAGGGATTCAACTAACTGGAGCCAGTAT
GAACCCCGCCAAGACATTGGTGCCTGCCATATTCTACGGCAGTCCGAATT
CGGTTCTAATGCAGCTGACTGGCCAGATCCTGGCCGCCATCATGGTGCCC
TTCGTGTGGAATCATGCGTATACGCCACCTTATAAGCCCTTGGAAATTCC
AGTGTGCAACTGAGCTGTGACAATAAACATAAGCTCGACGTTTTTGGCTA
CCGTGTGGCTTATTTGATCAAGTGTATGAGCAATTAAATATTAACGATAA
GCAAAAAAAAAAAAAAAAAA

GH26134.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5398-RA 1069 CG5398-RA 87..989 1..903 4515 100 Plus
CG5398.a 913 CG5398.a 235..913 224..902 3395 100 Plus
CG5398.a 913 CG5398.a 37..235 1..199 995 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19489145..19489549 223..627 2010 99.8 Plus
chr2R 21145070 chr2R 19489613..19489888 627..902 1380 100 Plus
chr2R 21145070 chr2R 19488868..19489091 1..224 1105 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:08:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23602898..23603302 223..627 2025 100 Plus
2R 25286936 2R 23603366..23603642 627..903 1385 100 Plus
2R 25286936 2R 23602621..23602844 1..224 1120 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23604097..23604501 223..627 2025 100 Plus
2R 25260384 2R 23604565..23604841 627..903 1385 100 Plus
2R 25260384 2R 23603820..23604043 1..224 1120 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:09:42 has no hits.

GH26134.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:10:28 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19489147..19489549 225..627 99 -> Plus
chr2R 19489614..19489888 628..902 100   Plus
chr2R 19488868..19489091 1..224 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:56:56 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
CG5398-RA 1..717 97..813 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:56:36 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
CG5398-RA 1..717 97..813 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:52:21 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
CG5398-RA 1..717 97..813 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:21:26 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
CG5398-RA 1..717 97..813 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:52:58 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
CG5398-RA 1..717 97..813 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:20:53 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
CG5398-RA 37..938 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:56:36 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
CG5398-RA 37..938 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:52:21 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
CG5398-RA 37..938 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:21:26 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
CG5398-RA 37..938 1..902 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:52:58 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
CG5398-RA 37..938 1..902 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:10:28 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23602621..23602844 1..224 100 -> Plus
2R 23602900..23603302 225..627 100 -> Plus
2R 23603367..23603641 628..902 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:10:28 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23602621..23602844 1..224 100 -> Plus
2R 23602900..23603302 225..627 100 -> Plus
2R 23603367..23603641 628..902 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:10:28 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23602621..23602844 1..224 100 -> Plus
2R 23602900..23603302 225..627 100 -> Plus
2R 23603367..23603641 628..902 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:52:21 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19490144..19490367 1..224 100 -> Plus
arm_2R 19490423..19490825 225..627 100 -> Plus
arm_2R 19490890..19491164 628..902 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:56:11 Download gff for GH26134.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23603838..23604061 1..224 100 -> Plus
2R 23604117..23604519 225..627 100 -> Plus
2R 23604584..23604858 628..902 100   Plus

GH26134.pep Sequence

Translation from 96 to 812

> GH26134.pep
MIWDFFTFIRGATEFSATALLILLGCMGDSTNQGGESKFLVASVHYGLTV
MVVMHVFGFVSGAHSNPCISISCYLMGYIALEVMMMYVVCQMAGAFLGYF
LLMQLLPKELVDKSKPGICLVQPMDTLSTYQVVIIECLLTAVLVLGWCSL
WDVRNGRFLDSVAIRMGLLVIACSFAGIQLTGASMNPAKTLVPAIFYGSP
NSVLMQLTGQILAAIMVPFVWNHAYTPPYKPLEIPVCN*

GH26134.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13068-PA 242 GF13068-PA 1..234 1..235 851 63.4 Plus
Dana\GF11832-PA 266 GF11832-PA 27..240 14..225 362 36.9 Plus
Dana\GF11831-PA 272 GF11831-PA 35..248 14..225 312 32.7 Plus
Dana\GF11830-PA 244 GF11830-PA 15..196 14..196 310 36.6 Plus
Dana\GF12394-PA 245 GF12394-PA 56..204 46..198 174 31.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22871-PA 238 GG22871-PA 1..238 1..238 1043 83.6 Plus
Dere\GG20012-PA 294 GG20012-PA 56..277 14..233 370 36 Plus
Dere\GG20010-PA 261 GG20010-PA 27..208 14..196 314 38.3 Plus
Dere\GG20011-PA 271 GG20011-PA 33..247 14..226 308 34 Plus
Dere\GG22646-PA 245 GG22646-PA 29..204 14..198 173 30.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20663-PA 250 GH20663-PA 1..235 1..233 713 57.9 Plus
Dgri\GH21221-PA 259 GH21221-PA 28..212 14..196 343 40.5 Plus
Dgri\GH21219-PA 246 GH21219-PA 15..193 14..196 328 37.7 Plus
Dgri\GH21220-PA 267 GH21220-PA 33..260 14..238 321 32.9 Plus
Dgri\GH21898-PA 205 GH21898-PA 1..205 20..233 215 28.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:53
Subject Length Description Subject Range Query Range Score Percent Strand
Eglp1-PA 238 CG5398-PA 1..238 1..238 1245 100 Plus
Eglp2-PA 265 CG17664-PA 27..249 14..234 383 35 Plus
Eglp2-PC 290 CG17664-PC 52..274 14..234 383 35 Plus
Eglp4-PB 249 CG4019-PB 15..196 14..196 347 37.7 Plus
Eglp4-PD 249 CG4019-PD 15..196 14..196 347 37.7 Plus
Eglp4-PA 249 CG4019-PA 15..196 14..196 347 37.7 Plus
Eglp4-PC 261 CG4019-PC 27..208 14..196 347 37.7 Plus
Eglp4-PE 286 CG4019-PE 52..233 14..196 347 37.7 Plus
Eglp4-PF 297 CG4019-PF 63..244 14..196 347 37.7 Plus
Eglp3-PB 270 CG17662-PB 33..246 14..225 321 33.6 Plus
Drip-PG 233 CG9023-PG 29..204 14..198 187 30.1 Plus
Drip-PE 239 CG9023-PE 23..198 14..198 187 30.1 Plus
Drip-PD 242 CG9023-PD 26..201 14..198 187 30.1 Plus
Drip-PC 243 CG9023-PC 27..202 14..198 187 30.1 Plus
Drip-PB 245 CG9023-PB 29..204 14..198 187 30.1 Plus
Drip-PA 245 CG9023-PA 29..204 14..198 187 30.1 Plus
Drip-PF 278 CG9023-PF 29..204 14..198 187 30.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19026-PA 242 GI19026-PA 1..230 1..234 696 54.3 Plus
Dmoj\GI20504-PA 249 GI20504-PA 14..199 13..199 328 38.5 Plus
Dmoj\GI20505-PA 274 GI20505-PA 38..265 14..238 307 33.3 Plus
Dmoj\GI20506-PA 247 GI20506-PA 19..244 14..236 297 33.2 Plus
Dmoj\GI21049-PA 247 GI21049-PA 29..234 14..222 180 29.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21483-PA 245 GL21483-PA 1..233 1..233 705 56.2 Plus
Dper\GL17596-PA 249 GL17596-PA 14..234 13..234 348 35.6 Plus
Dper\GL17598-PA 266 GL17598-PA 28..249 14..233 347 33.8 Plus
Dper\GL17597-PA 272 GL17597-PA 35..248 14..225 299 32.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26287-PA 245 GA26287-PA 1..233 1..233 695 56.2 Plus
Dpse\GA24838-PA 266 GA24838-PA 28..249 14..233 351 33.8 Plus
Dpse\GA17871-PA 249 GA17871-PA 14..234 13..234 350 35.6 Plus
Dpse\GA24837-PA 273 GA24837-PA 36..249 14..225 302 32.7 Plus
Dpse\GA24443-PA 244 GA24443-PA 56..204 46..198 169 30.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15524-PA 265 GM15524-PA 27..249 14..234 370 35.4 Plus
Dsec\GM15522-PA 261 GM15522-PA 27..208 14..196 327 39.3 Plus
Dsec\GM15523-PA 274 GM15523-PA 33..250 14..225 297 33.3 Plus
Dsec\GM20426-PA 245 GM20426-PA 29..204 14..198 175 30.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25028-PA 265 GD25028-PA 27..249 14..234 370 35.4 Plus
Dsim\GD25026-PA 261 GD25026-PA 27..208 14..196 331 39.3 Plus
Dsim\GD25027-PA 265 GD25027-PA 33..242 14..226 286 32.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19992-PA 248 GJ19992-PA 1..234 1..234 734 55.6 Plus
Dvir\GJ22357-PA 247 GJ22357-PA 16..229 14..225 341 35.5 Plus
Dvir\GJ22355-PA 252 GJ22355-PA 14..219 13..215 325 35.7 Plus
Dvir\GJ22124-PA 203 GJ22124-PA 1..190 20..222 256 29.1 Plus
Dvir\GJ22123-PA 242 GJ22123-PA 15..227 14..225 223 28.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23063-PA 292 GK23063-PA 1..233 1..233 796 60.1 Plus
Dwil\GK23178-PA 270 GK23178-PA 30..252 14..234 381 36.8 Plus
Dwil\GK23174-PA 249 GK23174-PA 15..196 14..196 336 40.4 Plus
Dwil\GK23177-PA 262 GK23177-PA 23..236 14..225 311 32.2 Plus
Dwil\GK23175-PA 238 GK23175-PA 16..233 2..226 234 28.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14309-PA 238 GE14309-PA 1..238 1..238 1114 86.6 Plus
Dyak\GE11549-PA 265 GE11549-PA 27..249 14..234 375 36.3 Plus
Dyak\GE11548-PA 271 GE11548-PA 33..246 14..225 324 34.6 Plus
Dyak\GE11546-PA 261 GE11546-PA 27..208 14..196 315 38.3 Plus
Dyak\GE13520-PA 245 GE13520-PA 29..204 14..198 177 30.3 Plus

GH26134.hyp Sequence

Translation from 96 to 812

> GH26134.hyp
MIWDFFTFIRGATEFSATALLILLGCMGDSTNQGGESKFLVASVHYGLTV
MVVMHVFGFVSGAHSNPCISISCYLMGYIALEVMMMYVVCQMAGAFLGYF
LLMQLLPKELVDKSKPGICLVQPMDTLSTYQVVIIECLLTAVLVLGWCSL
WDVRNGRFLDSVAIRMGLLVIACSFAGIQLTGASMNPAKTLVPAIFYGSP
NSVLMQLTGQILAAIMVPFVWNHAYTPPYKPLEIPVCN*

GH26134.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5398-PA 238 CG5398-PA 1..238 1..238 1245 100 Plus
CG17664-PA 265 CG17664-PA 27..249 14..234 383 35 Plus
CG17664-PC 290 CG17664-PC 52..274 14..234 383 35 Plus
CG4019-PB 249 CG4019-PB 15..196 14..196 347 37.7 Plus
CG4019-PD 249 CG4019-PD 15..196 14..196 347 37.7 Plus