Clone GH26351 Report

Search the DGRC for GH26351

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:263
Well:51
Vector:pOT2
Associated Gene/TranscriptChmp1-RA
Protein status:GH26351.pep: gold
Preliminary Size:937
Sequenced Size:820

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4108 2001-01-01 Release 2 assignment
CG4108 2001-10-10 Blastp of sequenced clone
CG4108 2003-01-01 Sim4 clustering to Release 3
Chmp1 2008-04-29 Release 5.5 accounting
Chmp1 2008-08-15 Release 5.9 accounting
Chmp1 2008-12-18 5.12 accounting

Clone Sequence Records

GH26351.complete Sequence

820 bp (820 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060798

> GH26351.complete
AAATCCTCCAATAAAAACAACGTAGATTGATCAAATTCGTCGGTTTGAGT
TGCAAACCAACACCTAATATTTTTTCTTCGTTCGTCATTGTAAATTCGTC
AAGCTGGGTAACGACATGTCTACGAGTTCCATGGAAAAACACCTTTTCAA
TCTAAAGTTTGCCGTAAAGGAATTGGAACGAAACTCAAAGAAATGTGAGA
AGGAGGAGAAGCTGGAGAAGGCAAAGGCCAAGAAGGCGATTCAGAAGGGC
AACATGGACGTGGCCCGCATCCACGCAGAGAATGCGATCCGCCAGAAGAA
CCAGGCGGTTAACTACCTCAGGATGAGTGCCCGAGTGGATGCAGTGGCCA
GTAGGGTTCAGTCCGCACTCACCACCCGCAAGGTCACCGGCTCCATGGCC
GGCGTGGTCAAGGCCATGGATGCAGCTATGAAGGGTATGAACCTGGAGAA
GATTTCCTCCCTGATGGAGAAGTTTGAATCGCAGTTCGAAGACCTGGACG
TCCAGAGCTCGGTAATGGAGGGCACCATGTCCGACACGGTAACCACCTCG
GTGCCTCAGGGAGATGTCGACAATCTGCTCCAGCAAGTGGCCGACGAGGC
TGGCCTCGAACTCAACATGGAGCTGCCCAGCGGAGTTCAGAGCCAATCCG
TTGGAGCCTCGACAGCAGTGTCCCAAGAGCAAGACGAGCTCACCCAGCGA
CTGGCACGTCTCCGCCAGGCTGAATAAAAATAGCGACGCCCTGCCCGTTG
AATTTCTGTTTTAGCAATTAAGTACATTCAAAATATAAATAAGTATAAAC
TCAAAAAAAAAAAAAAAAAA

GH26351.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Chmp1-RA 1193 Chmp1-RA 134..936 1..803 4015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18672824..18673488 802..138 3310 99.8 Minus
chr3L 24539361 chr3L 18673560..18673696 137..1 685 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:08:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18683143..18683808 803..138 3330 100 Minus
3L 28110227 3L 18683880..18684016 137..1 685 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18676243..18676908 803..138 3330 100 Minus
3L 28103327 3L 18676980..18677116 137..1 685 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:11:55 has no hits.

GH26351.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:12:47 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18672824..18673488 138..802 99 <- Minus
chr3L 18673560..18673696 1..137 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:57:15 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
Chmp1-RA 1..612 116..727 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:42 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
Chmp1-RA 1..612 116..727 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:45:51 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
Chmp1-RA 1..612 116..727 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:49 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
Chmp1-RA 1..612 116..727 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:13:33 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
Chmp1-RA 1..612 116..727 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:44 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
Chmp1-RA 44..845 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:42 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
Chmp1-RA 44..845 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:45:51 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
Chmp1-RA 46..847 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:50 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
Chmp1-RA 44..845 1..802 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:13:33 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
Chmp1-RA 46..847 1..802 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:47 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18683144..18683808 138..802 100 <- Minus
3L 18683880..18684016 1..137 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:47 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18683144..18683808 138..802 100 <- Minus
3L 18683880..18684016 1..137 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:47 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18683144..18683808 138..802 100 <- Minus
3L 18683880..18684016 1..137 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:45:51 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18676980..18677116 1..137 100   Minus
arm_3L 18676244..18676908 138..802 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:03:02 Download gff for GH26351.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18676244..18676908 138..802 100 <- Minus
3L 18676980..18677116 1..137 100   Minus

GH26351.hyp Sequence

Translation from 115 to 726

> GH26351.hyp
MSTSSMEKHLFNLKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVA
RIHAENAIRQKNQAVNYLRMSARVDAVASRVQSALTTRKVTGSMAGVVKA
MDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVMEGTMSDTVTTSVPQGD
VDNLLQQVADEAGLELNMELPSGVQSQSVGASTAVSQEQDELTQRLARLR
QAE*

GH26351.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Chmp1-PB 203 CG4108-PB 1..203 1..203 982 100 Plus
Chmp1-PA 203 CG4108-PA 1..203 1..203 982 100 Plus
Vps2-PA 256 CG14542-PA 15..201 6..189 237 28.3 Plus
CHMP2B-PA 212 CG4618-PA 22..212 12..202 160 19.9 Plus

GH26351.pep Sequence

Translation from 115 to 726

> GH26351.pep
MSTSSMEKHLFNLKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVA
RIHAENAIRQKNQAVNYLRMSARVDAVASRVQSALTTRKVTGSMAGVVKA
MDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVMEGTMSDTVTTSVPQGD
VDNLLQQVADEAGLELNMELPSGVQSQSVGASTAVSQEQDELTQRLARLR
QAE*

GH26351.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10809-PA 203 GF10809-PA 1..203 1..203 1022 96.6 Plus
Dana\GF16804-PA 252 GF16804-PA 25..191 16..179 174 29.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15729-PA 203 GG15729-PA 1..203 1..203 1053 100 Plus
Dere\GG11461-PA 256 GG11461-PA 22..201 13..189 178 28.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17196-PA 203 GH17196-PA 1..203 1..203 1023 96.6 Plus
Dgri\GH19462-PA 259 GH19462-PA 22..197 13..184 172 29.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Chmp1-PB 203 CG4108-PB 1..203 1..203 982 100 Plus
Chmp1-PA 203 CG4108-PA 1..203 1..203 982 100 Plus
Vps2-PA 256 CG14542-PA 15..201 6..189 237 28.3 Plus
CHMP2B-PA 212 CG4618-PA 22..212 12..202 160 19.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11307-PA 203 GI11307-PA 1..203 1..203 1024 96.1 Plus
Dmoj\GI24696-PA 253 GI24696-PA 22..196 13..184 167 27.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22691-PA 198 GL22691-PA 1..198 1..203 862 92.2 Plus
Dper\GL21825-PA 256 GL21825-PA 22..196 13..184 174 29.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17963-PA 204 GA17963-PA 1..204 1..203 925 96.1 Plus
Dpse\GA13067-PA 256 GA13067-PA 22..196 13..184 173 28.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14926-PA 203 GM14926-PA 1..203 1..203 1053 100 Plus
Dsec\GM10303-PA 256 GM10303-PA 22..201 13..189 178 28.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12332-PA 203 GD12332-PA 1..203 1..203 1053 100 Plus
Dsim\GD21266-PA 256 GD21266-PA 22..201 13..189 178 28.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14099-PA 203 GJ14099-PA 1..203 1..203 1037 98 Plus
Dvir\GJ23912-PA 251 GJ23912-PA 25..191 16..179 166 28.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10775-PA 203 GK10775-PA 1..203 1..203 1050 99 Plus
Dwil\GK14462-PA 251 GK14462-PA 22..198 13..185 181 31.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Chmp1-PA 203 GE22062-PA 1..203 1..203 1049 99.5 Plus
Dyak\GE23653-PA 256 GE23653-PA 22..201 13..189 177 28.9 Plus