Clone GH26392 Report

Search the DGRC for GH26392

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:263
Well:92
Vector:pOT2
Associated Gene/TranscriptCG32278-RA
Protein status:GH26392.pep: gold
Preliminary Size:957
Sequenced Size:825

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12032 2001-01-01 Release 2 assignment
CG32278 2001-10-10 Blastp of sequenced clone
CG32278 2008-04-29 Release 5.5 accounting
CG32278 2008-08-15 Release 5.9 accounting
CG32278 2008-12-18 5.12 accounting

Clone Sequence Records

GH26392.complete Sequence

825 bp (825 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060799

> GH26392.complete
ATCCGATCTTGAATTTTGGAATTAATAGAGATGGGTCGCAACAAGGCAAA
CAACAAGAAGGTTACTCCTGGGGCCGCCAAGCCAAAGTCGGCTCTGAACA
AGTCCAAAAAGGCCAAGAACGTATTCAAAGTGGGCGACGGTAACAAGGGC
AAGGGCAAGAAGCCCAAGGAAGTGCAGGGCAAGCTCAAGCAGATCAAGGA
ATCTGTTAAAGCTAAGCAGGAGAAATTGGACGCCAGCCTGAAGACTCTAC
ACAAGGATCTGGTGGTGAAGAAGCCAAAGGCACCTGTGGCACCCATCAAG
AGCTACAAGAAGAAGGGGGTCGATGCCCAGAAAGTGTCCGACACACTAAG
CAAACTCAAGTTCTAAGCAACTCCGCCGGAGACCATGTTTCACGTATAGA
TGCATATACGTATTACGCATAGATGTAGTTAGTCCCCATTGATTGTTAAT
AACTTTGGTGCAATGTTGCCAGCAGTGGCAATGATTATCCAAAATATACG
TTAGCTATTCCGACAGTGATGGGAAGTCCTCAGCCAGGTGGAGACTACGT
AGCCAAATACCTCTTGACCTCTTTTAAAGCTAGCATAAATTCAGAATTTC
ATTCCTGATAAGTATAATATCCAATGAATAGGCTTGGAAAATAACAGTTG
ATCCCCAATTTATTTTTACAAATATTGTGCAACTCTTACCATACGAGTGC
GCTTTATCTTACGTAATTGGTAAGTTGTTATATGTTGAATCCTTCCTAGG
AATGGGTGACTCCCCATCACTGTGCTATGGCAGCCTAGACAACCACAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

GH26392.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG32278-RA 1004 CG32278-RA 57..853 1..797 3985 100 Plus
CG14963-RA 933 CG14963-RA 779..933 797..643 775 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3170609..3171213 189..796 2885 98.7 Plus
chr3L 24539361 chr3L 3170392..3170555 29..192 820 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:08:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3171160..3171768 189..797 3045 100 Plus
3L 28110227 3L 3170943..3171106 29..192 820 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3171160..3171768 189..797 3045 100 Plus
3L 28103327 3L 3170943..3171106 29..192 820 100 Plus
3L 28103327 3L 3169335..3169364 1..30 150 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:33:48 has no hits.

GH26392.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:34:40 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3168784..3168813 1..30 100 -> Plus
chr3L 3170394..3170555 31..192 100 -> Plus
chr3L 3170613..3171213 193..796 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:57:19 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
CG32278-RA 1..336 31..366 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:43 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
CG32278-RA 1..336 31..366 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:48:06 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
CG32278-RA 1..336 31..366 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:51 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
CG32278-RA 1..336 31..366 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:43:49 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
CG32278-RA 1..336 31..366 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:45 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
CG32278-RA 49..844 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:43 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
CG32278-RA 49..844 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:48:06 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
CG32278-RA 50..845 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:51 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
CG32278-RA 49..844 1..796 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:43:49 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
CG32278-RA 50..845 1..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:40 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3169335..3169364 1..30 100 -> Plus
3L 3170945..3171106 31..192 100 -> Plus
3L 3171164..3171767 193..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:40 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3169335..3169364 1..30 100 -> Plus
3L 3170945..3171106 31..192 100 -> Plus
3L 3171164..3171767 193..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:40 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3169335..3169364 1..30 100 -> Plus
3L 3170945..3171106 31..192 100 -> Plus
3L 3171164..3171767 193..796 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:48:06 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3169335..3169364 1..30 100 -> Plus
arm_3L 3170945..3171106 31..192 100 -> Plus
arm_3L 3171164..3171767 193..796 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:03:03 Download gff for GH26392.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3171164..3171767 193..796 100   Plus
3L 3169335..3169364 1..30 100 -> Plus
3L 3170945..3171106 31..192 100 -> Plus

GH26392.hyp Sequence

Translation from 30 to 365

> GH26392.hyp
MGRNKANNKKVTPGAAKPKSALNKSKKAKNVFKVGDGNKGKGKKPKEVQG
KLKQIKESVKAKQEKLDASLKTLHKDLVVKKPKAPVAPIKSYKKKGVDAQ
KVSDTLSKLKF*

GH26392.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG32278-PA 111 CG32278-PA 1..111 1..111 556 100 Plus

GH26392.pep Sequence

Translation from 30 to 365

> GH26392.pep
MGRNKANNKKVTPGAAKPKSALNKSKKAKNVFKVGDGNKGKGKKPKEVQG
KLKQIKESVKAKQEKLDASLKTLHKDLVVKKPKAPVAPIKSYKKKGVDAQ
KVSDTLSKLKF*

GH26392.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20073-PA 111 GF20073-PA 1..111 1..111 390 86.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15107-PA 111 GG15107-PA 1..111 1..111 391 91 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16198-PA 120 GH16198-PA 1..120 1..111 258 60.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG32278-PA 111 CG32278-PA 1..111 1..111 556 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13348-PA 116 GI13348-PA 28..116 21..111 226 70.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24891-PA 110 GL24891-PA 1..110 1..111 391 77.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16806-PA 110 GA16806-PA 1..110 1..111 391 77.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14541-PA 111 GM14541-PA 1..111 1..111 428 91.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13734-PA 111 GD13734-PA 1..111 1..111 428 91.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13176-PA 114 GJ13176-PA 1..114 1..111 272 64.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25496-PA 115 GK25496-PA 1..115 1..111 341 75.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21331-PA 111 GE21331-PA 1..111 1..111 393 91 Plus