BDGP Sequence Production Resources |
Search the DGRC for GH26392
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 263 |
Well: | 92 |
Vector: | pOT2 |
Associated Gene/Transcript | CG32278-RA |
Protein status: | GH26392.pep: gold |
Preliminary Size: | 957 |
Sequenced Size: | 825 |
Gene | Date | Evidence |
---|---|---|
CG12032 | 2001-01-01 | Release 2 assignment |
CG32278 | 2001-10-10 | Blastp of sequenced clone |
CG32278 | 2008-04-29 | Release 5.5 accounting |
CG32278 | 2008-08-15 | Release 5.9 accounting |
CG32278 | 2008-12-18 | 5.12 accounting |
825 bp (825 high quality bases) assembled on 2001-10-10
GenBank Submission: AY060799
> GH26392.complete ATCCGATCTTGAATTTTGGAATTAATAGAGATGGGTCGCAACAAGGCAAA CAACAAGAAGGTTACTCCTGGGGCCGCCAAGCCAAAGTCGGCTCTGAACA AGTCCAAAAAGGCCAAGAACGTATTCAAAGTGGGCGACGGTAACAAGGGC AAGGGCAAGAAGCCCAAGGAAGTGCAGGGCAAGCTCAAGCAGATCAAGGA ATCTGTTAAAGCTAAGCAGGAGAAATTGGACGCCAGCCTGAAGACTCTAC ACAAGGATCTGGTGGTGAAGAAGCCAAAGGCACCTGTGGCACCCATCAAG AGCTACAAGAAGAAGGGGGTCGATGCCCAGAAAGTGTCCGACACACTAAG CAAACTCAAGTTCTAAGCAACTCCGCCGGAGACCATGTTTCACGTATAGA TGCATATACGTATTACGCATAGATGTAGTTAGTCCCCATTGATTGTTAAT AACTTTGGTGCAATGTTGCCAGCAGTGGCAATGATTATCCAAAATATACG TTAGCTATTCCGACAGTGATGGGAAGTCCTCAGCCAGGTGGAGACTACGT AGCCAAATACCTCTTGACCTCTTTTAAAGCTAGCATAAATTCAGAATTTC ATTCCTGATAAGTATAATATCCAATGAATAGGCTTGGAAAATAACAGTTG ATCCCCAATTTATTTTTACAAATATTGTGCAACTCTTACCATACGAGTGC GCTTTATCTTACGTAATTGGTAAGTTGTTATATGTTGAATCCTTCCTAGG AATGGGTGACTCCCCATCACTGTGCTATGGCAGCCTAGACAACCACAAAA AAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 3168784..3168813 | 1..30 | 100 | -> | Plus |
chr3L | 3170394..3170555 | 31..192 | 100 | -> | Plus |
chr3L | 3170613..3171213 | 193..796 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32278-RA | 1..336 | 31..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32278-RA | 1..336 | 31..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32278-RA | 1..336 | 31..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32278-RA | 1..336 | 31..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32278-RA | 1..336 | 31..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32278-RA | 49..844 | 1..796 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32278-RA | 49..844 | 1..796 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32278-RA | 50..845 | 1..796 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32278-RA | 49..844 | 1..796 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32278-RA | 50..845 | 1..796 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3169335..3169364 | 1..30 | 100 | -> | Plus |
3L | 3170945..3171106 | 31..192 | 100 | -> | Plus |
3L | 3171164..3171767 | 193..796 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3169335..3169364 | 1..30 | 100 | -> | Plus |
3L | 3170945..3171106 | 31..192 | 100 | -> | Plus |
3L | 3171164..3171767 | 193..796 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3169335..3169364 | 1..30 | 100 | -> | Plus |
3L | 3170945..3171106 | 31..192 | 100 | -> | Plus |
3L | 3171164..3171767 | 193..796 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 3169335..3169364 | 1..30 | 100 | -> | Plus |
arm_3L | 3170945..3171106 | 31..192 | 100 | -> | Plus |
arm_3L | 3171164..3171767 | 193..796 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3171164..3171767 | 193..796 | 100 | Plus | |
3L | 3169335..3169364 | 1..30 | 100 | -> | Plus |
3L | 3170945..3171106 | 31..192 | 100 | -> | Plus |
Translation from 30 to 365
> GH26392.hyp MGRNKANNKKVTPGAAKPKSALNKSKKAKNVFKVGDGNKGKGKKPKEVQG KLKQIKESVKAKQEKLDASLKTLHKDLVVKKPKAPVAPIKSYKKKGVDAQ KVSDTLSKLKF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32278-PA | 111 | CG32278-PA | 1..111 | 1..111 | 556 | 100 | Plus |
Translation from 30 to 365
> GH26392.pep MGRNKANNKKVTPGAAKPKSALNKSKKAKNVFKVGDGNKGKGKKPKEVQG KLKQIKESVKAKQEKLDASLKTLHKDLVVKKPKAPVAPIKSYKKKGVDAQ KVSDTLSKLKF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20073-PA | 111 | GF20073-PA | 1..111 | 1..111 | 390 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15107-PA | 111 | GG15107-PA | 1..111 | 1..111 | 391 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16198-PA | 120 | GH16198-PA | 1..120 | 1..111 | 258 | 60.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32278-PA | 111 | CG32278-PA | 1..111 | 1..111 | 556 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13348-PA | 116 | GI13348-PA | 28..116 | 21..111 | 226 | 70.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24891-PA | 110 | GL24891-PA | 1..110 | 1..111 | 391 | 77.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16806-PA | 110 | GA16806-PA | 1..110 | 1..111 | 391 | 77.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14541-PA | 111 | GM14541-PA | 1..111 | 1..111 | 428 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13734-PA | 111 | GD13734-PA | 1..111 | 1..111 | 428 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13176-PA | 114 | GJ13176-PA | 1..114 | 1..111 | 272 | 64.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25496-PA | 115 | GK25496-PA | 1..115 | 1..111 | 341 | 75.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21331-PA | 111 | GE21331-PA | 1..111 | 1..111 | 393 | 91 | Plus |