Clone GH26786 Report

Search the DGRC for GH26786

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:267
Well:86
Vector:pOT2
Associated Gene/Transcriptfln-RA
Protein status:GH26786.pep: gold
Preliminary Size:1101
Sequenced Size:995

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7445 2001-01-01 Release 2 assignment
CG7445 2001-10-10 Blastp of sequenced clone
CG7445 2003-01-01 Sim4 clustering to Release 3
fln 2008-04-29 Release 5.5 accounting
fln 2008-08-15 Release 5.9 accounting
fln 2008-12-18 5.12 accounting

Clone Sequence Records

GH26786.complete Sequence

995 bp (995 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060802

> GH26786.complete
TATAAACACTATAGTAAAGTAATATGGCAGACGAAGAAGATCCATGGGGT
TTCGACGACGGCGGCGAGGAGGAGAAGGCGGCATCCACCCAGGCGGGCAC
TCCGGCCCCACCCTCAAAAGCACCGAGTGTGGCATCCGATCACAAGGCTG
ATAGCGTCGTGGCTGGCACTCCGGCCAACGAGGAGGCTGCTCCGGAAGAG
GTAGAAGAAATCAAAGCACCGCCGCCTCCGCCAGAAGACGATGGTTACAG
GAAACCGGTGCAGCTCTACCGCCACTGGGTCAGGCCGAAGTTTCTGCAAT
ACAAATACATGTACAACTACAGAACCAACTATTACGATGATGTAATTGAC
TATATCGACAAAAAACAAACTGGAGTGGCCCGGGAAATACCAAGACCACA
GACGTGGGCGGAACGTGTCCTGCGCACACGGAATATCAGTGGCAGTGACA
TTGATTCGTATGCACCGGCAAAGAGGGACAAACAACTAATTCAAACACTG
GCGGCCTCGATAAGAACTTATAATTACCACACCAAGGCATATATCAACCA
AAGGTATGCCAGTGTCCTTTAGTAAGCGCACCTAAATGTACCAATAGAAC
CGTCGGACGAACGGATGAGCACTCGTAGTTATATAAAGGGTAACCACCCA
TTGTCAAAAGATCCATACGTACATATGTGTATAGTCAGTCAGTAAGCGTT
TGCATATCTGCGCATCTCAAAACTCTGTATCCTGAATCTGCCTTATGGAG
TGGAGACCTTTCAAGAAAACGAATATTGTATATTTTTTCTTACATGCGTA
ATTTCTGTTAATATATTGCCATATGTACTTATTCATATATATTAACACAA
CTTACCTCTCAATACATGGTATTTTTAAGGTTATTTACTTCATTTTTAGC
AAAGTGAGTAAATAAAACAAACCTATTTATATTGTAAAGCTTAAAATAAA
AACTGTGCAATAAATAAAACTAAATAAAAAAAAAAAAAAAAAAAA

GH26786.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
fln-RA 1230 fln-RA 256..1230 1..975 4875 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19978869..19979408 975..436 2700 100 Minus
chr3L 24539361 chr3L 19979688..19979954 284..18 1335 100 Minus
chr3L 24539361 chr3L 19979467..19979626 439..280 800 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:09:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19989548..19990090 978..436 2715 100 Minus
3L 28110227 3L 19990370..19990636 284..18 1335 100 Minus
3L 28110227 3L 19990149..19990308 439..280 800 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19982648..19983190 978..436 2715 100 Minus
3L 28103327 3L 19983470..19983736 284..18 1335 100 Minus
3L 28103327 3L 19983249..19983408 439..280 800 100 Minus
Blast to na_te.dros performed 2019-03-16 03:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
TART-C 11124 TART-C TARTC 11124bp 391..474 911..825 121 63.2 Minus
rover 7318 rover ROVER 7318bp 3978..4016 878..840 114 76.9 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 1152..1230 905..825 112 61.7 Minus

GH26786.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:05:08 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19978869..19979404 440..975 100 <- Minus
chr3L 19979467..19979622 284..439 100 <- Minus
chr3L 19979689..19979952 20..283 100 <- Minus
chr3L 19980467..19980485 1..19 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:57:54 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
fln-RA 1..549 24..572 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:04 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
fln-RA 1..549 24..572 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:54 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
fln-RA 1..549 24..572 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:13 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
fln-RA 1..549 24..572 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:29:44 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
fln-RA 1..549 24..572 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:41:59 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
fln-RA 1..975 1..975 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:04 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
fln-RA 13..987 1..975 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:54 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
fln-RA 13..987 1..975 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:13 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
fln-RA 1..975 1..975 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:29:44 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
fln-RA 54..1028 1..975 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:08 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19989551..19990086 440..975 100 <- Minus
3L 19990149..19990304 284..439 100 <- Minus
3L 19990371..19990634 20..283 100 <- Minus
3L 19991149..19991167 1..19 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:08 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19989551..19990086 440..975 100 <- Minus
3L 19990149..19990304 284..439 100 <- Minus
3L 19990371..19990634 20..283 100 <- Minus
3L 19991149..19991167 1..19 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:08 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19989551..19990086 440..975 100 <- Minus
3L 19990149..19990304 284..439 100 <- Minus
3L 19990371..19990634 20..283 100 <- Minus
3L 19991149..19991167 1..19 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:54 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19984249..19984267 1..19 100   Minus
arm_3L 19982651..19983186 440..975 100 <- Minus
arm_3L 19983249..19983404 284..439 100 <- Minus
arm_3L 19983471..19983734 20..283 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:24 Download gff for GH26786.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19982651..19983186 440..975 100 <- Minus
3L 19983249..19983404 284..439 100 <- Minus
3L 19983471..19983734 20..283 100 <- Minus
3L 19984249..19984267 1..19 100   Minus

GH26786.hyp Sequence

Translation from 23 to 571

> GH26786.hyp
MADEEDPWGFDDGGEEEKAASTQAGTPAPPSKAPSVASDHKADSVVAGTP
ANEEAAPEEVEEIKAPPPPPEDDGYRKPVQLYRHWVRPKFLQYKYMYNYR
TNYYDDVIDYIDKKQTGVAREIPRPQTWAERVLRTRNISGSDIDSYAPAK
RDKQLIQTLAASIRTYNYHTKAYINQRYASVL*

GH26786.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
fln-PB 182 CG7445-PB 1..182 1..182 974 100 Plus
fln-PA 182 CG7445-PA 1..182 1..182 974 100 Plus

GH26786.pep Sequence

Translation from 23 to 571

> GH26786.pep
MADEEDPWGFDDGGEEEKAASTQAGTPAPPSKAPSVASDHKADSVVAGTP
ANEEAAPEEVEEIKAPPPPPEDDGYRKPVQLYRHWVRPKFLQYKYMYNYR
TNYYDDVIDYIDKKQTGVAREIPRPQTWAERVLRTRNISGSDIDSYAPAK
RDKQLIQTLAASIRTYNYHTKAYINQRYASVL*

GH26786.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10833-PA 185 GF10833-PA 1..185 1..182 728 87 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13353-PA 185 GG13353-PA 1..185 1..182 921 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14726-PA 179 GH14726-PA 1..179 1..182 642 72.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
fln-PB 182 CG7445-PB 1..182 1..182 974 100 Plus
fln-PA 182 CG7445-PA 1..182 1..182 974 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13378-PA 183 GI13378-PA 1..183 1..182 674 71.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25050-PA 187 GL25050-PA 1..187 1..182 729 77.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22938-PA 181 GA22938-PA 1..181 7..182 698 76.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14859-PA 182 GM14859-PA 1..182 1..182 953 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12234-PA 182 GD12234-PA 1..182 1..182 953 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11502-PA 187 GJ11502-PA 1..187 1..182 646 70 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18981-PA 189 GK18981-PA 1..189 1..182 676 75.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\fln-PA 182 GE22446-PA 1..182 1..182 949 99.5 Plus