Clone GH26960 Report

Search the DGRC for GH26960

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:269
Well:60
Vector:pOT2
Associated Gene/TranscriptPorin2-RA
Protein status:GH26960.pep: gold
Preliminary Size:1130
Sequenced Size:1123

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17137 2002-01-01 Sim4 clustering to Release 2
CG17137 2002-05-18 Blastp of sequenced clone
CG17137 2003-01-01 Sim4 clustering to Release 3
Porin2 2008-04-29 Release 5.5 accounting
Porin2 2008-08-15 Release 5.9 accounting
Porin2 2008-12-18 5.12 accounting

Clone Sequence Records

GH26960.complete Sequence

1123 bp (1123 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118823

> GH26960.complete
CTCGATACTGATCAGGCAGCGTTAGACATAAATTTTCGGCTAATCGAGGC
TGTTGAAAAGTAGACAAAAAATTTCGAAATTAGTCGGGCCATATATACCA
TACCACCTATTCATACAGCCCGTAATGGCCGCCAAAACACCGACATACCC
AGATCTGGGCAAGCTGGCCCGCGATCTCTTCAAGCGCGGCTACCATCCGG
GCATCTGGCAGATCGACTGCAAGACCCTGACCAATTCGGGGATTGAGTTC
TTCACCACCGGCTTCGCCAGCCAGGACAACAGCAAGGTGACCGGCTCGCT
TCAGAGCAAGTACAAGATCGAGGACCAAGGCCTGACCCTAACCGAGCGAT
GGAACACGGAGAACTGGCTCTTCGGTGAGATTATGCACCGGGATAAGTTG
GCACAGGGCCTGATGTTGGCCGTCGAGGCCAAGTTTCAGCCGGGATCAAA
TGAGGCGGATGGCAAGTTCAAGATGGGCTATGCCCAGGACAACTTTAACT
TCCTGGCCGACATTGGACTGAACTCGGAGCCGATACTCAACTGTTCGCTG
GTTGTGGGCCACAAGGAGTTCCTCGGCGGCGTGGGCACCGAATTTGACGT
TGGCAACACCGAACTCAAGGGCTGGAAGGTGGCCCTTGGTTGGACAAATG
AAACTGCCACCCTCCATGGCGAGCTGAAGAACGGCGACACCTGGTTGGCC
TCGCTGTTCTACAAGGCGAGCGAGAAGATCGATGCCGGTATCGAGGTAAC
CAAGGGAGCCGGCGGCGGCGAAGCTGCCGAGGGTGAACAGCAGGGCGGAG
ATGTGGTCGTCAATCTGGGCATGATCTACCACTTGGAGGAGGATGCCCTC
GTACGCGCCAAGGTCAACAACCTGGTGGAGCTGGGCCTGGGCTATGAACA
GAAACTGCGCGACGGCATCACCGCCTCCATATCCGCCGTGCTGGATTGCA
ACAACTTTAAGGACGGAAACCATCGGTTCGGCGTGGGAATTGCCCTCCAG
TGCTAAAATGACTGCCAATCACTTAACGATTTCAATTTCTAAATTTATTT
TTAAGTTTATCTTTATTCAAATGACAAATATATTTTGTTCTTCATAATGG
CAATATAAAAAAAAAAAAAAAAA

GH26960.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Porin2-RA 1238 Porin2-RA 128..1235 1..1108 5540 100 Plus
Porin2.a 1108 Porin2.a 116..1105 119..1108 4950 100 Plus
Porin2.a 1108 Porin2.a 57..115 1..59 295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10845343..10845792 450..1 2250 100 Minus
chr2L 23010047 chr2L 10844558..10844988 1106..676 2155 100 Minus
chr2L 23010047 chr2L 10845051..10845276 676..451 1130 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:09:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10846573..10847022 450..1 2250 100 Minus
2L 23513712 2L 10845786..10846218 1108..676 2165 100 Minus
2L 23513712 2L 10846281..10846506 676..451 1130 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10846573..10847022 450..1 2250 100 Minus
2L 23513712 2L 10845786..10846218 1108..676 2165 100 Minus
2L 23513712 2L 10846281..10846506 676..451 1130 100 Minus
2L 23513712 2L 10848630..10848702 364..292 155 80.8 Minus
Blast to na_te.dros performed 2019-03-15 15:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 1427..1495 1101..1034 136 70.4 Minus

GH26960.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:35:34 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10845052..10845276 451..675 100 <- Minus
chr2L 10844558..10844988 676..1106 100 <- Minus
chr2L 10845343..10845792 1..450 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:58:04 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
Porin2-RA 1..882 125..1006 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:45:41 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
Porin2-RA 1..882 125..1006 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:32:49 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
Porin2-RA 1..882 125..1006 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:01 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
Porin2-RA 1..882 125..1006 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:09:52 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
Porin2-RA 1..882 125..1006 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:21:07 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
Porin2-RA 23..1128 1..1106 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:45:41 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
Porin2-RA 23..1128 1..1106 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:32:49 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
Porin2-RA 23..1128 1..1106 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:02 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
Porin2-RA 23..1128 1..1106 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:09:52 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
Porin2-RA 23..1128 1..1106 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:34 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10845788..10846218 676..1106 100 <- Minus
2L 10846282..10846506 451..675 100 <- Minus
2L 10846573..10847022 1..450 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:34 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10845788..10846218 676..1106 100 <- Minus
2L 10846282..10846506 451..675 100 <- Minus
2L 10846573..10847022 1..450 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:34 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10845788..10846218 676..1106 100 <- Minus
2L 10846282..10846506 451..675 100 <- Minus
2L 10846573..10847022 1..450 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:32:49 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10846282..10846506 451..675 100 <- Minus
arm_2L 10845788..10846218 676..1106 100 <- Minus
arm_2L 10846573..10847022 1..450 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:18 Download gff for GH26960.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10845788..10846218 676..1106 100 <- Minus
2L 10846282..10846506 451..675 100 <- Minus
2L 10846573..10847022 1..450 100   Minus

GH26960.pep Sequence

Translation from 124 to 1005

> GH26960.pep
MAAKTPTYPDLGKLARDLFKRGYHPGIWQIDCKTLTNSGIEFFTTGFASQ
DNSKVTGSLQSKYKIEDQGLTLTERWNTENWLFGEIMHRDKLAQGLMLAV
EAKFQPGSNEADGKFKMGYAQDNFNFLADIGLNSEPILNCSLVVGHKEFL
GGVGTEFDVGNTELKGWKVALGWTNETATLHGELKNGDTWLASLFYKASE
KIDAGIEVTKGAGGGEAAEGEQQGGDVVVNLGMIYHLEEDALVRAKVNNL
VELGLGYEQKLRDGITASISAVLDCNNFKDGNHRFGVGIALQC*

GH26960.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14060-PA 301 GF14060-PA 7..301 2..293 1248 80.3 Plus
Dana\GF14059-PA 315 GF14059-PA 37..315 6..293 629 42.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10350-PA 295 GG10350-PA 1..295 1..293 1491 95.6 Plus
Dere\GG10349-PA 282 GG10349-PA 4..282 6..293 628 42.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13332-PA 296 GH13332-PA 2..296 3..293 904 59.8 Plus
Dgri\GH14201-PA 283 GH14201-PA 2..283 3..293 675 45.8 Plus
Dgri\GH13331-PA 282 GH13331-PA 4..282 6..293 618 41.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
Porin2-PB 293 CG17137-PB 1..293 1..293 1550 100 Plus
Porin2-PA 293 CG17137-PA 1..293 1..293 1550 100 Plus
porin-PE 282 CG6647-PE 4..281 6..292 643 42.4 Plus
porin-PD 282 CG6647-PD 4..281 6..292 643 42.4 Plus
porin-PC 282 CG6647-PC 4..281 6..292 643 42.4 Plus
porin-PB 282 CG6647-PB 4..281 6..292 643 42.4 Plus
porin-PA 282 CG6647-PA 4..281 6..292 643 42.4 Plus
CG17139-PA 340 CG17139-PA 57..333 1..286 150 22.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17808-PA 288 GI17808-PA 4..288 6..293 908 61.8 Plus
Dmoj\GI17807-PA 282 GI17807-PA 4..282 6..293 630 42.2 Plus
Dmoj\GI16915-PA 330 GI16915-PA 50..330 1..293 170 20.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26380-PA 297 GL26380-PA 4..297 6..293 1111 68.4 Plus
Dper\GL26379-PA 282 GL26379-PA 4..282 6..293 624 42.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14341-PA 297 GA14341-PA 4..297 6..293 1111 68 Plus
Dpse\GA19750-PA 282 GA19750-PA 4..282 6..293 624 42.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11369-PA 293 GM11369-PA 1..293 1..293 1506 96.6 Plus
Dsec\GM11358-PA 282 GM11358-PA 4..282 6..293 630 42.2 Plus
Dsec\GM11391-PA 361 GM11391-PA 83..361 6..293 157 23.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22219-PA 293 GD22219-PA 1..293 1..293 1508 96.9 Plus
Dsim\GD22218-PA 282 GD22218-PA 4..282 6..293 630 42.2 Plus
Dsim\GD22221-PA 361 GD22221-PA 83..361 6..293 156 23.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17633-PA 292 GJ17633-PA 2..292 3..293 963 61.6 Plus
Dvir\GJ17632-PA 304 GJ17632-PA 26..304 6..293 627 42.2 Plus
Dvir\GJ17635-PA 309 GJ17635-PA 31..309 4..293 176 22.1 Plus
Dvir\GJ17634-PA 320 GJ17634-PA 39..320 1..293 175 23.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23976-PA 292 GK23976-PA 4..292 6..293 1096 69.6 Plus
Dwil\GK23973-PA 282 GK23973-PA 4..282 6..293 615 41.9 Plus
Dwil\GK23974-PA 323 GK23974-PA 46..321 7..291 187 26.4 Plus
Dwil\GK23975-PA 502 GK23975-PA 225..496 7..287 170 23.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13251-PA 296 GE13251-PA 1..296 1..293 1499 95.6 Plus
Dyak\porin-PA 282 GE13240-PA 4..282 6..293 630 42.2 Plus
Dyak\GE13273-PA 359 GE13273-PA 81..359 6..293 159 24.4 Plus
Dyak\GE13262-PA 342 GE13262-PA 57..336 1..287 152 22.9 Plus

GH26960.hyp Sequence

Translation from 124 to 1005

> GH26960.hyp
MAAKTPTYPDLGKLARDLFKRGYHPGIWQIDCKTLTNSGIEFFTTGFASQ
DNSKVTGSLQSKYKIEDQGLTLTERWNTENWLFGEIMHRDKLAQGLMLAV
EAKFQPGSNEADGKFKMGYAQDNFNFLADIGLNSEPILNCSLVVGHKEFL
GGVGTEFDVGNTELKGWKVALGWTNETATLHGELKNGDTWLASLFYKASE
KIDAGIEVTKGAGGGEAAEGEQQGGDVVVNLGMIYHLEEDALVRAKVNNL
VELGLGYEQKLRDGITASISAVLDCNNFKDGNHRFGVGIALQC*

GH26960.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Porin2-PB 293 CG17137-PB 1..293 1..293 1550 100 Plus
Porin2-PA 293 CG17137-PA 1..293 1..293 1550 100 Plus
porin-PE 282 CG6647-PE 4..281 6..292 643 42.4 Plus
porin-PD 282 CG6647-PD 4..281 6..292 643 42.4 Plus
porin-PC 282 CG6647-PC 4..281 6..292 643 42.4 Plus