Clone GH26991 Report

Search the DGRC for GH26991

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:269
Well:91
Vector:pOT2
Associated Gene/TranscriptCorp-RA
Protein status:GH26991.pep: gold
Preliminary Size:1149
Sequenced Size:1069

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10965 2001-01-01 Release 2 assignment
CG10965 2001-10-10 Blastp of sequenced clone
CG10965 2003-01-01 Sim4 clustering to Release 3
Corp 2008-04-29 Release 5.5 accounting
Corp 2008-08-15 Release 5.9 accounting
Corp 2008-12-18 5.12 accounting

Clone Sequence Records

GH26991.complete Sequence

1069 bp (1069 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060803

> GH26991.complete
CGAACGCATCGCTGCGAGAAAAACAGTGCAAAATAATAGAGAGAGTTGAA
GAAGGATTACCAGTGTGAAGATCGTTATCAATTTTACTACTATATACGAA
AAGAAAACCAAAGGATGGCCGATATCAGGAGCAGCTTGAAGGTTCTCTTC
CAGGGCGAGACCAACCTCATCACTTGCGGATCCTCGAACACTTACGAAGA
GGTCATCTCCCAAGCCATGACCCGCTTCGCCATTCCGGAGACACAAAGGA
AAGCCCTCATCCTGACCAACGGCAAGGACTACGTGTTTGAGGCGCATTTG
CTGGAGTATTTCCTGCTTTTGTTCCCCTGCCCGGAGATCACCTTTCACCT
GAGATTTGACTGGTCAAAGATGCGCCGCAGTCTGGGCCAGACCGAGTCCC
TTAAGCGAAAGCGTCTAGTGGATTTGGAGCAAGCCGAGGGTCAGAAGGAG
GAGGACCAAGAAAAGGAAGATCCGGTGCCGGAGTACAAGCCGGTGCCGGT
CTACCGGATGAATTGCTTCCTGGGATCGCTGCCCACTGCCGGCGCCATTC
CTGTGCATCGTCAGAACTGTTTCCTTAGGGAACAGTCGCAGCAGCAGCTG
GATGAGATTTCCATACCTCGGCTGCAGGAGGACGATGACCAAAAGGAGCC
GCCCAAGAAGCGCCAGCGCGTGGACGTCTGTTCGAAGCCAAGACGCACAG
CGTCCACGTCGGTTGGTCCGTCTCCCGTTCCTGTCATGCGCTCGATTCGC
ATCTAGGTCGCCAATCATGGATTGTACATAGCTCTACTACGTATACGATA
CTCCAATTAGATGTATTCATAAGCTAAAAGGTTGAACCATTGTTCCTAAG
ACTTACACTGCAGTAATCGCACCAAACAAACGTCCAAACCAAATGTTATA
TTATGTAAAAAATAACCATTTTTGTTAATAATTTTAAGCTATGTGAATGA
AACATACTTTAGATCCTAAGCAATCTTCTGGCCTATTATGATTTGAGATT
TAATTAATCGCCGTAATAAACTTTTTTTTCAAATAAACTAGTTATAAATA
TAAAAAAAAAAAAAAAAAA

GH26991.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
Corp-RA 1540 Corp-RA 354..1408 1..1055 5275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8161837..8162676 1051..213 4060 99.2 Minus
chrX 22417052 chrX 8162971..8163184 214..1 1040 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:09:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8270026..8270868 1055..213 4215 100 Minus
X 23542271 X 8271163..8271376 214..1 1070 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8278124..8278966 1055..213 4215 100 Minus
X 23527363 X 8279261..8279474 214..1 1070 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:26:18 has no hits.

GH26991.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:27:10 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8161837..8162674 215..1051 99 <- Minus
chrX 8162971..8163184 1..214 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:58:05 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
Corp-RA 1..642 115..756 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:44 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
Corp-RA 1..642 115..756 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:03:26 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
Corp-RA 1..642 115..756 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:52 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
Corp-RA 1..642 115..756 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:10:32 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
Corp-RA 1..642 115..756 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:47 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
Corp-RA 29..1079 1..1051 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:44 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
Corp-RA 29..1079 1..1051 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:03:26 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
Corp-RA 34..1084 1..1051 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:52 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
Corp-RA 29..1079 1..1051 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:10:32 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
Corp-RA 34..1084 1..1051 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:10 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
X 8270030..8270866 215..1051 100 <- Minus
X 8271163..8271376 1..214 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:10 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
X 8270030..8270866 215..1051 100 <- Minus
X 8271163..8271376 1..214 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:10 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
X 8270030..8270866 215..1051 100 <- Minus
X 8271163..8271376 1..214 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:03:26 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8165196..8165409 1..214 100   Minus
arm_X 8164063..8164899 215..1051 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:03:04 Download gff for GH26991.complete
Subject Subject Range Query Range Percent Splice Strand
X 8278128..8278964 215..1051 100 <- Minus
X 8279261..8279474 1..214 100   Minus

GH26991.hyp Sequence

Translation from 114 to 755

> GH26991.hyp
MADIRSSLKVLFQGETNLITCGSSNTYEEVISQAMTRFAIPETQRKALIL
TNGKDYVFEAHLLEYFLLLFPCPEITFHLRFDWSKMRRSLGQTESLKRKR
LVDLEQAEGQKEEDQEKEDPVPEYKPVPVYRMNCFLGSLPTAGAIPVHRQ
NCFLREQSQQQLDEISIPRLQEDDDQKEPPKKRQRVDVCSKPRRTASTSV
GPSPVPVMRSIRI*

GH26991.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Corp-PB 213 CG10965-PB 1..213 1..213 1106 100 Plus
Corp-PA 213 CG10965-PA 1..213 1..213 1106 100 Plus

GH26991.pep Sequence

Translation from 114 to 755

> GH26991.pep
MADIRSSLKVLFQGETNLITCGSSNTYEEVISQAMTRFAIPETQRKALIL
TNGKDYVFEAHLLEYFLLLFPCPEITFHLRFDWSKMRRSLGQTESLKRKR
LVDLEQAEGQKEEDQEKEDPVPEYKPVPVYRMNCFLGSLPTAGAIPVHRQ
NCFLREQSQQQLDEISIPRLQEDDDQKEPPKKRQRVDVCSKPRRTASTSV
GPSPVPVMRSIRI*

GH26991.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22445-PA 211 GF22445-PA 1..211 1..213 537 54 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17972-PA 214 GG17972-PA 1..214 1..213 995 87.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12412-PA 217 GH12412-PA 1..217 1..213 392 41.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
Corp-PB 213 CG10965-PB 1..213 1..213 1106 100 Plus
Corp-PA 213 CG10965-PA 1..213 1..213 1106 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15867-PA 211 GI15867-PA 1..211 1..213 442 43.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19909-PA 212 GL19909-PA 1..212 1..213 622 57.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10673-PA 212 GA10673-PA 1..212 1..213 622 57.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21463-PA 214 GM21463-PA 1..214 1..213 1086 94.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16122-PA 214 GD16122-PA 1..214 1..213 1095 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19025-PA 217 GJ19025-PA 1..217 4..213 406 42.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16314-PA 232 GK16314-PA 1..156 1..156 385 49.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17464-PA 214 GE17464-PA 1..214 1..213 1010 89.3 Plus