GH26995.complete Sequence
711 bp (711 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113351
> GH26995.complete
ATTTTGAGTTTCGTTTCGCAAAGCCAGCCAGCCAGCCAGCCAGTCCGCAG
GAGCAGTAATCGAATGGGAGTCATGTTGGTCAAGGTCTTGATGTTCGCAT
TGTGGCTCGTGGCCCTGAGCCAGGCGAAGCCCCAGCTGTTGGTCACGACG
CCAGTGAGTTATGCCACCGGAGCGGGTGCCTCTTGGCTGGCTCCCTCCTC
CGCCGCTTACTATCCGGCGTATGCCAGCTATCCGGCCTACGCGGCGTATG
CGTATGCACCGGTTTATGGCGCATACGCCACGTATCCATACTACTCGTAT
CTAGGGCGGTGAATCCTGCTGCTGCGGGCCAACCGGAATACTAGGTGAAT
TTGTAGCTATTCCGGGCTTGTGTACAGTGGCAGCAATGTTCCACTTACTA
GAAGCAGTGTGATTGGATTTACAAACGTAAGCTGAGTATAAGAAATTAAT
AACTTTTTTGTTTGGTAAATGTAAAAAAAATATTACTCAAAGTGATTGCA
ATTGCTACAACTAATATAACATTTAAAGTGTCCCTTGTGAAATTAATGTT
CCTTAGATTTATAACTAAAATCTATAGCTTTCTTTTGAAATTGAAAATTG
GCCCACCTTTAGATAATTCTTTAAGATTATTAATAAACAATCCTTGTATA
AATATAACAAATATCGAAATGCAATAAATAACTGTCAACTCGAAAAAAAA
AAAAAAAAAAA
GH26995.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:12:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8012-RA | 858 | CG8012-RA | 163..858 | 1..696 | 3480 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:39:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 8207560..8208158 | 93..692 | 2905 | 99.3 | Plus |
chr3L | 24539361 | chr3L | 8207429..8207492 | 30..93 | 320 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:10:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:39:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 8215599..8216202 | 93..696 | 3020 | 100 | Plus |
3L | 28110227 | 3L | 8215439..8215531 | 1..93 | 465 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 8208699..8209302 | 93..696 | 3020 | 100 | Plus |
3L | 28103327 | 3L | 8208539..8208631 | 1..93 | 465 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 03:39:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Penelope | 4158 | Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). | 709..817 | 649..538 | 120 | 61.4 | Minus |
Penelope | 804 | Penelope 804bp Derived from AF418572 (AF418572) (Rel. 70, Last updated, Version 3). | 264..372 | 649..538 | 120 | 61.4 | Minus |
Cr1a | 4470 | Cr1a DMCR1A 4470bp | 23..98 | 682..612 | 117 | 64.5 | Minus |
Dvir\Tv1 | 6868 | Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). | 5994..6084 | 655..566 | 110 | 60.9 | Minus |
gypsy9 | 5349 | gypsy9 GYPSY9 5349bp | 257..345 | 685..598 | 109 | 61.1 | Minus |
gypsy9 | 5349 | gypsy9 GYPSY9 5349bp | 5270..5347 | 685..609 | 108 | 63.3 | Minus |
GH26995.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:41:04 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 8207561..8208158 | 94..692 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:58:09 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8012-RA | 1..249 | 64..312 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:57:18 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8012-RA | 1..249 | 64..312 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:00:57 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8012-RA | 1..249 | 64..312 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:37 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8012-RA | 1..249 | 64..312 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:10:31 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8012-RA | 1..249 | 64..312 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:37:09 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8012-RA | 9..700 | 1..692 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:57:18 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8012-RA | 9..700 | 1..692 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:00:57 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8012-RB | 160..851 | 1..692 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:37 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8012-RA | 9..700 | 1..692 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:10:31 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8012-RB | 160..851 | 1..692 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:04 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 8215600..8216198 | 94..692 | 100 | | Plus |
3L | 8215439..8215531 | 1..93 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:04 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 8215600..8216198 | 94..692 | 100 | | Plus |
3L | 8215439..8215531 | 1..93 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:04 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 8215600..8216198 | 94..692 | 100 | | Plus |
3L | 8215439..8215531 | 1..93 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:00:57 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 8208539..8208631 | 1..93 | 100 | -> | Plus |
arm_3L | 8208700..8209298 | 94..692 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:33 Download gff for
GH26995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 8208700..8209298 | 94..692 | 100 | | Plus |
3L | 8208539..8208631 | 1..93 | 100 | -> | Plus |
GH26995.hyp Sequence
Translation from 0 to 311
> GH26995.hyp
ILSFVSQSQPASQPVRRSSNRMGVMLVKVLMFALWLVALSQAKPQLLVTT
PVSYATGAGASWLAPSSAAYYPAYASYPAYAAYAYAPVYGAYATYPYYSY
LGR*
GH26995.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:38:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8012-PB | 82 | CG8012-PB | 1..82 | 22..103 | 429 | 100 | Plus |
CG8012-PA | 82 | CG8012-PA | 1..82 | 22..103 | 429 | 100 | Plus |
GH26995.pep Sequence
Translation from 63 to 311
> GH26995.pep
MGVMLVKVLMFALWLVALSQAKPQLLVTTPVSYATGAGASWLAPSSAAYY
PAYASYPAYAAYAYAPVYGAYATYPYYSYLGR*
GH26995.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:48:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF25104-PA | 79 | GF25104-PA | 1..79 | 4..82 | 236 | 81.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:48:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG14289-PA | 78 | GG14289-PA | 1..78 | 4..82 | 337 | 97.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8012-PB | 82 | CG8012-PB | 1..82 | 1..82 | 429 | 100 | Plus |
CG8012-PA | 82 | CG8012-PA | 1..82 | 1..82 | 429 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:48:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL22538-PA | 80 | GL22538-PA | 1..80 | 4..82 | 156 | 70 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:48:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA24621-PA | 80 | GA24621-PA | 1..80 | 4..82 | 156 | 70 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:48:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25031-PA | 82 | GM25031-PA | 1..82 | 1..82 | 375 | 98.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:48:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14064-PA | 82 | GD14064-PA | 1..82 | 1..82 | 372 | 98.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:48:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20719-PA | 78 | GE20719-PA | 1..78 | 4..82 | 338 | 96.2 | Plus |