Clone GH26995 Report

Search the DGRC for GH26995

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:269
Well:95
Vector:pOT2
Associated Gene/TranscriptCG8012-RA
Protein status:GH26995.pep: gold
Preliminary Size:847
Sequenced Size:711

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8012 2002-01-01 Sim4 clustering to Release 2
CG8012 2002-04-26 Blastp of sequenced clone
CG8012 2003-01-01 Sim4 clustering to Release 3
CG8012 2008-04-29 Release 5.5 accounting
CG8012 2008-08-15 Release 5.9 accounting
CG8012 2008-12-18 5.12 accounting

Clone Sequence Records

GH26995.complete Sequence

711 bp (711 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113351

> GH26995.complete
ATTTTGAGTTTCGTTTCGCAAAGCCAGCCAGCCAGCCAGCCAGTCCGCAG
GAGCAGTAATCGAATGGGAGTCATGTTGGTCAAGGTCTTGATGTTCGCAT
TGTGGCTCGTGGCCCTGAGCCAGGCGAAGCCCCAGCTGTTGGTCACGACG
CCAGTGAGTTATGCCACCGGAGCGGGTGCCTCTTGGCTGGCTCCCTCCTC
CGCCGCTTACTATCCGGCGTATGCCAGCTATCCGGCCTACGCGGCGTATG
CGTATGCACCGGTTTATGGCGCATACGCCACGTATCCATACTACTCGTAT
CTAGGGCGGTGAATCCTGCTGCTGCGGGCCAACCGGAATACTAGGTGAAT
TTGTAGCTATTCCGGGCTTGTGTACAGTGGCAGCAATGTTCCACTTACTA
GAAGCAGTGTGATTGGATTTACAAACGTAAGCTGAGTATAAGAAATTAAT
AACTTTTTTGTTTGGTAAATGTAAAAAAAATATTACTCAAAGTGATTGCA
ATTGCTACAACTAATATAACATTTAAAGTGTCCCTTGTGAAATTAATGTT
CCTTAGATTTATAACTAAAATCTATAGCTTTCTTTTGAAATTGAAAATTG
GCCCACCTTTAGATAATTCTTTAAGATTATTAATAAACAATCCTTGTATA
AATATAACAAATATCGAAATGCAATAAATAACTGTCAACTCGAAAAAAAA
AAAAAAAAAAA

GH26995.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG8012-RA 858 CG8012-RA 163..858 1..696 3480 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8207560..8208158 93..692 2905 99.3 Plus
chr3L 24539361 chr3L 8207429..8207492 30..93 320 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:10:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8215599..8216202 93..696 3020 100 Plus
3L 28110227 3L 8215439..8215531 1..93 465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8208699..8209302 93..696 3020 100 Plus
3L 28103327 3L 8208539..8208631 1..93 465 100 Plus
Blast to na_te.dros performed 2019-03-16 03:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 709..817 649..538 120 61.4 Minus
Penelope 804 Penelope 804bp Derived from AF418572 (AF418572) (Rel. 70, Last updated, Version 3). 264..372 649..538 120 61.4 Minus
Cr1a 4470 Cr1a DMCR1A 4470bp 23..98 682..612 117 64.5 Minus
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 5994..6084 655..566 110 60.9 Minus
gypsy9 5349 gypsy9 GYPSY9 5349bp 257..345 685..598 109 61.1 Minus
gypsy9 5349 gypsy9 GYPSY9 5349bp 5270..5347 685..609 108 63.3 Minus

GH26995.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:41:04 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8207561..8208158 94..692 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:58:09 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 1..249 64..312 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:57:18 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 1..249 64..312 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:00:57 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 1..249 64..312 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:37 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 1..249 64..312 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:10:31 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 1..249 64..312 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:37:09 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 9..700 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:57:18 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 9..700 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:00:57 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RB 160..851 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:37 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 9..700 1..692 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:10:31 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RB 160..851 1..692 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:04 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8215600..8216198 94..692 100   Plus
3L 8215439..8215531 1..93 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:04 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8215600..8216198 94..692 100   Plus
3L 8215439..8215531 1..93 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:04 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8215600..8216198 94..692 100   Plus
3L 8215439..8215531 1..93 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:00:57 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8208539..8208631 1..93 100 -> Plus
arm_3L 8208700..8209298 94..692 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:33 Download gff for GH26995.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8208700..8209298 94..692 100   Plus
3L 8208539..8208631 1..93 100 -> Plus

GH26995.hyp Sequence

Translation from 0 to 311

> GH26995.hyp
ILSFVSQSQPASQPVRRSSNRMGVMLVKVLMFALWLVALSQAKPQLLVTT
PVSYATGAGASWLAPSSAAYYPAYASYPAYAAYAYAPVYGAYATYPYYSY
LGR*

GH26995.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8012-PB 82 CG8012-PB 1..82 22..103 429 100 Plus
CG8012-PA 82 CG8012-PA 1..82 22..103 429 100 Plus

GH26995.pep Sequence

Translation from 63 to 311

> GH26995.pep
MGVMLVKVLMFALWLVALSQAKPQLLVTTPVSYATGAGASWLAPSSAAYY
PAYASYPAYAAYAYAPVYGAYATYPYYSYLGR*

GH26995.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25104-PA 79 GF25104-PA 1..79 4..82 236 81.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14289-PA 78 GG14289-PA 1..78 4..82 337 97.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8012-PB 82 CG8012-PB 1..82 1..82 429 100 Plus
CG8012-PA 82 CG8012-PA 1..82 1..82 429 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22538-PA 80 GL22538-PA 1..80 4..82 156 70 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24621-PA 80 GA24621-PA 1..80 4..82 156 70 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25031-PA 82 GM25031-PA 1..82 1..82 375 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14064-PA 82 GD14064-PA 1..82 1..82 372 98.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20719-PA 78 GE20719-PA 1..78 4..82 338 96.2 Plus