Clone GH27120 Report

Search the DGRC for GH27120

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:271
Well:20
Vector:pOT2
Associated Gene/TranscriptCG17765-RA
Protein status:GH27120.pep: gold
Preliminary Size:1085
Sequenced Size:969

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17765 2001-01-01 Release 2 assignment
CG17765 2001-10-10 Blastp of sequenced clone
CG17765 2003-01-01 Sim4 clustering to Release 3
CG17765 2008-04-29 Release 5.5 accounting
CG17765 2008-08-15 Release 5.9 accounting
CG17765 2008-12-18 5.12 accounting

Clone Sequence Records

GH27120.complete Sequence

969 bp (969 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060804

> GH27120.complete
AAATTGTTTTGTCCCTCAAGTTCCAATTAGAATCGAACTAGGCTCGTGAC
AAAATGTCTTATGGACAAGGCTATAACCCGTATGCCCAGCCCGGTGGTGG
CTATGCCCCGCCGCCAGGAGCATTTCCGCCGCAGAATGCCCAGGTGTCTC
CGCAGGCACAGCAATGGTTCTCCATGGTGGACCGCGACCGATCTGGAAAG
ATAAACGCTTCCGAGTTGCAGGCGGCCCTGGTGAATGGGCGTGGCGATCA
CTTCTCGGATAATGCCTGCAAGCTGATGATAAGCATGTTCGACAACGACG
CCAGTGGTACCATCGATATCTATGAGTTCGAGAAGCTCTACAACTACATC
AACCAATGGCTGCAAGTCTTCAAGACCTACGATCAGGACTCCTCTGGACA
TATCGAGGAACAGGAGCTGACCCAAGCCTTCACCCAGATGGGCTTTCGAT
TCTCGCCCGAATTCATAAACTTCCTGGTGAAGAAGAGCGACCCCCAGGGC
CACAAAGAGGTGTCCGTGGATCAGTTCATAGTGCTCTGCGTGCAGGTGCA
GCGTTTCACGGAGGCCTTCAGGCAGCGCGACACCCAGCAGAATGGAACCA
TCACCATTGGGTTCGAGGACTTCCTCACCGTGGCCATTGGCTGCTCGTAT
TGAAAGAATGATTCAATGCAACCGCTCCATGGGAATGCATCTCCACAGTC
TTGCACACACACACACACACACTACAGCCAACAGTGGATGATCATAAATT
TCGCGACTGGTGCATTTTTCTTAAATTTTCAACGGTGTTAGCTTTTTAAT
ATGTAAATGAATCACTCCACAGTCATATTGCAATCTCCTGGTATCAGAAT
CAAATTTCAAAAGTATTTGTTAACGCAGTTCGACTCAATAATCATAGTAC
AAAGTCTCTTGCGCCTAATAATAAACTATACACACGTATTTTTAAAAATT
AAAAAAAAAAAAAAAAAAA

GH27120.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG17765-RA 1013 CG17765-RA 60..1013 1..954 4770 100 Plus
CG17765.a 1294 CG17765.a 60..1013 1..954 4770 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6368924..6369449 425..950 2630 100 Plus
chr2R 21145070 chr2R 6367878..6368098 63..283 1105 100 Plus
chr2R 21145070 chr2R 6368654..6368733 283..362 400 100 Plus
chr2R 21145070 chr2R 6368790..6368854 362..426 325 100 Plus
chr2R 21145070 chr2R 6367757..6367819 1..63 315 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:10:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10481361..10481890 425..954 2650 100 Plus
2R 25286936 2R 10480323..10480543 63..283 1105 100 Plus
2R 25286936 2R 10481090..10481169 283..362 400 100 Plus
2R 25286936 2R 10481226..10481290 362..426 325 100 Plus
2R 25286936 2R 10480202..10480264 1..63 315 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10482560..10483089 425..954 2650 100 Plus
2R 25260384 2R 10481522..10481742 63..283 1105 100 Plus
2R 25260384 2R 10482289..10482368 283..362 400 100 Plus
2R 25260384 2R 10482425..10482489 362..426 325 100 Plus
2R 25260384 2R 10481401..10481463 1..63 315 100 Plus
Blast to na_te.dros performed on 2019-03-15 12:26:42 has no hits.

GH27120.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:27:35 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6367757..6367818 1..62 100 -> Plus
chr2R 6367878..6368097 63..282 100 -> Plus
chr2R 6368654..6368733 283..362 100 -> Plus
chr2R 6368791..6368854 363..426 100 -> Plus
chr2R 6368926..6369449 427..950 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:58:15 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17765-RA 1..600 54..653 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:46 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17765-RA 1..600 54..653 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:42:57 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17765-RA 1..600 54..653 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:57 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17765-RA 1..600 54..653 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:59:43 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17765-RA 1..600 54..653 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:48 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17765-RA 43..992 1..950 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:46 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17765-RA 43..992 1..950 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:42:57 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17765-RA 40..989 1..950 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:57 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17765-RA 43..992 1..950 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:59:43 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17765-RA 40..989 1..950 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:27:35 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10480202..10480263 1..62 100 -> Plus
2R 10480323..10480542 63..282 100 -> Plus
2R 10481090..10481169 283..362 100 -> Plus
2R 10481227..10481290 363..426 100 -> Plus
2R 10481363..10481886 427..950 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:27:35 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10480202..10480263 1..62 100 -> Plus
2R 10480323..10480542 63..282 100 -> Plus
2R 10481090..10481169 283..362 100 -> Plus
2R 10481227..10481290 363..426 100 -> Plus
2R 10481363..10481886 427..950 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:27:35 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10480202..10480263 1..62 100 -> Plus
2R 10480323..10480542 63..282 100 -> Plus
2R 10481090..10481169 283..362 100 -> Plus
2R 10481227..10481290 363..426 100 -> Plus
2R 10481363..10481886 427..950 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:42:57 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6367707..6367768 1..62 100 -> Plus
arm_2R 6367828..6368047 63..282 100 -> Plus
arm_2R 6368595..6368674 283..362 100 -> Plus
arm_2R 6368732..6368795 363..426 100 -> Plus
arm_2R 6368868..6369391 427..950 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:03:06 Download gff for GH27120.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10482289..10482368 283..362 100 -> Plus
2R 10482426..10482489 363..426 100 -> Plus
2R 10481522..10481741 63..282 100 -> Plus
2R 10482562..10483085 427..950 100   Plus
2R 10481401..10481462 1..62 100 -> Plus

GH27120.hyp Sequence

Translation from 53 to 652

> GH27120.hyp
MSYGQGYNPYAQPGGGYAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKI
NASELQAALVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYIN
QWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGH
KEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAIGCSY*

GH27120.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG17765-PA 199 CG17765-PA 1..199 1..199 1063 100 Plus
Alg-2-PC 178 CG40410-PC 18..172 39..193 337 41.9 Plus
CalpA-PC 828 CG7563-PC 699..822 67..191 204 30.4 Plus
CalpA-PB 828 CG7563-PB 699..822 67..191 204 30.4 Plus
CalpA-PD 843 CG7563-PD 714..837 67..191 204 30.4 Plus

GH27120.pep Sequence

Translation from 53 to 652

> GH27120.pep
MSYGQGYNPYAQPGGGYAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKI
NASELQAALVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYIN
QWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGH
KEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAIGCSY*

GH27120.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13767-PA 199 GF13767-PA 1..199 1..199 1022 94 Plus
Dana\GF20561-PA 177 GF20561-PA 17..172 39..194 330 41 Plus
Dana\GF12340-PA 829 GF12340-PA 700..827 67..195 211 31.8 Plus
Dana\GF10580-PA 929 GF10580-PA 777..927 42..195 205 30.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20134-PA 199 GG20134-PA 1..199 1..199 1063 99 Plus
Dere\GG13144-PA 125 GG13144-PA 1..120 75..194 255 39.2 Plus
Dere\GG21969-PA 843 GG21969-PA 714..841 67..195 208 30.2 Plus
Dere\GG15419-PA 926 GG15419-PA 795..924 65..195 202 32.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21258-PA 199 GH21258-PA 1..199 1..199 855 88.4 Plus
Dgri\GH15184-PA 178 GH15184-PA 2..173 18..194 350 39.5 Plus
Dgri\GH22343-PA 125 GH22343-PA 1..120 75..194 256 39.2 Plus
Dgri\GH16049-PA 936 GH16049-PA 784..934 42..195 215 32.7 Plus
Dgri\GH20201-PA 199 GH20201-PA 70..197 67..195 208 31 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG17765-PA 199 CG17765-PA 1..199 1..199 1063 100 Plus
Alg-2-PC 178 CG40410-PC 18..172 39..193 337 41.9 Plus
CalpA-PC 828 CG7563-PC 699..822 67..191 204 30.4 Plus
CalpA-PB 828 CG7563-PB 699..822 67..191 204 30.4 Plus
CalpA-PD 843 CG7563-PD 714..837 67..191 204 30.4 Plus
CalpB-PB 925 CG8107-PB 794..919 65..191 190 32.3 Plus
CalpB-PA 925 CG8107-PA 794..919 65..191 190 32.3 Plus
Cam-PD 149 CG8472-PD 17..145 39..161 140 26.2 Plus
Cam-PC 149 CG8472-PC 17..145 39..161 140 26.2 Plus
Cam-PE 149 CG8472-PE 17..145 39..161 140 26.2 Plus
Cam-PB 149 CG8472-PB 17..145 39..161 140 26.2 Plus
Cam-PA 149 CG8472-PA 17..145 39..161 140 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19336-PA 199 GI19336-PA 1..199 1..199 980 89.4 Plus
Dmoj\GI23980-PA 158 GI23980-PA 1..153 42..194 333 41.8 Plus
Dmoj\GI18428-PA 122 GI18428-PA 1..119 78..196 231 34.5 Plus
Dmoj\GI20726-PA 822 GI20726-PA 672..820 45..195 221 31.8 Plus
Dmoj\GI12314-PA 920 GI12314-PA 789..918 65..195 202 33.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17295-PA 196 GL17295-PA 1..196 1..199 1003 94.5 Plus
Dper\GL12353-PA 168 GL12353-PA 2..163 33..194 337 39.5 Plus
Dper\GL10930-PA 230 GL10930-PA 101..228 67..195 212 30.4 Plus
Dper\GL12520-PA 925 GL12520-PA 794..923 65..195 201 32.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14655-PA 196 GA14655-PA 1..196 1..199 1003 94.5 Plus
Dpse\GA30215-PA 178 GA30215-PA 18..173 39..194 338 41 Plus
Dpse\GA24537-PA 828 GA24537-PA 699..826 67..195 212 30.4 Plus
Dpse\GA20829-PA 931 GA20829-PA 800..929 65..195 202 32.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21221-PA 199 GM21221-PA 1..199 1..199 1064 99.5 Plus
Dsec\GM19651-PA 285 GM19651-PA 18..142 39..163 262 40 Plus
Dsec\GM21958-PA 843 GM21958-PA 714..841 67..195 210 30.2 Plus
Dsec\GM25192-PA 925 GM25192-PA 794..923 65..195 205 33.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10744-PA 199 GD10744-PA 1..199 1..199 1064 99.5 Plus
Dsim\GD12853-PA 200 GD12853-PA 18..142 39..163 272 40.8 Plus
Dsim\GD11453-PA 843 GD11453-PA 714..841 67..195 212 30.2 Plus
Dsim\GD14224-PA 925 GD14224-PA 794..923 65..195 205 33.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22214-PA 199 GJ22214-PA 1..199 1..199 1014 94 Plus
Dvir\GJ20462-PA 821 GJ20462-PA 692..819 67..195 212 31.8 Plus
Dvir\GJ13250-PA 918 GJ13250-PA 787..916 65..195 205 34.6 Plus
Dvir\GJ15116-PA 151 GJ15116-PA 13..141 36..158 141 27.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10715-PA 200 GK10715-PA 1..200 1..199 1019 95 Plus
Dwil\GK14354-PA 161 GK14354-PA 4..156 42..194 344 42.5 Plus
Dwil\GK16784-PA 919 GK16784-PA 787..917 64..195 218 35.8 Plus
Dwil\GK15868-PA 824 GK15868-PA 697..814 67..185 186 30.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12824-PA 198 GE12824-PA 1..198 1..199 1039 97.5 Plus
Dyak\GE12048-PA 828 GE12048-PA 699..826 67..195 213 30.2 Plus
Dyak\GE21727-PA 924 GE21727-PA 793..922 65..195 204 33.1 Plus