Clone GH27221 Report

Search the DGRC for GH27221

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:272
Well:21
Vector:pOT2
Associated Gene/TranscriptCG31955-RA
Protein status:GH27221.pep: gold
Sequenced Size:675

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31955 2003-01-01 Sim4 clustering to Release 3
CG31955 2008-04-29 Release 5.5 accounting
CG31955 2008-08-15 Release 5.9 accounting
CG31955 2008-12-18 5.12 accounting

Clone Sequence Records

GH27221.complete Sequence

675 bp assembled on 2007-02-23

GenBank Submission: BT030405

> GH27221.complete
TATTCAGTAGACATCAGTCGAGCGCAGAAGCTCTTCGTGATAAGACGTCT
TCAATTCAAATTTTTTTTATCGAACACACCATGGAGGGGGACAAGGTAGT
TTTTCATAGTTCTGATCTACCATACGAATATTTATACGACGACGAAAAAC
ACGTTTCGCACATGCCGGATTCCAAATTAAGTGTACGAAATATTTTGGAT
TCAGCTTACGCTTCTGCTGAAGGCAAAATTATAACTAGGAAACTTTCGCG
CAGCATTCCGCCGTATCCGCATGCTGTTCGAGTAAAAAATGGCATTCGTG
TTTATGAATACAGTGAGCCCAGAAAACAGAGCTACAAATCAAGTTTATGG
AAGGAGGCCTACAATATACTCCACCAGCGGTTGGATATTGCCGAGCCAAT
CGCAGCAAAGGAACACGTGAGAACGCAGATACATCCGTGTCTGCACAAGA
TCAAAGGACTTCTAGATCCGGAAACCTGCATCAAGTGTCCGCGGTGTCAT
AAGTCCATTTCGTCCACCAAAGTTGTGAAAAGCTTTGCATAGTGACGAAT
GCAAGCCACCTTCAACATATATATCTATTATAGAGGTTCAATATATGCTC
AAATCAACACATGCATTTATATATATATATAATATAAACAAAGAATGCAA
CAGCCCTAAAAAAAAAAAAAAAAAA

GH27221.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG31955-RA 932 CG31955-RA 203..860 1..658 3290 100 Plus
CG31955.a 947 CG31955.a 1..658 1..658 3290 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3712014..3712378 365..1 1765 98.9 Minus
chr2L 23010047 chr2L 3711670..3711961 657..366 1445 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:10:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3712498..3712862 365..1 1825 100 Minus
2L 23513712 2L 3712153..3712445 658..366 1465 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3712498..3712862 365..1 1825 100 Minus
2L 23513712 2L 3712153..3712445 658..366 1465 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:53:58 has no hits.

GH27221.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:55:15 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3711670..3711961 366..657 91 <- Minus
chr2L 3712014..3712378 1..365 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:58:28 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31955-RA 1..462 81..542 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:32 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31955-RA 1..462 81..542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:48 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31955-RA 1..462 81..542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:13 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31955-RA 1..462 81..542 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:54:04 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31955-RA 1..462 81..542 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:51:15 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31955-RA 1..655 1..655 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:31 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31955-RA 1..657 1..657 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:48 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31955-RA 5..661 1..657 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:13 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31955-RA 1..655 1..655 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:54:04 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31955-RA 5..661 1..657 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:15 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3712154..3712445 366..657 100 <- Minus
2L 3712498..3712862 1..365 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:15 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3712154..3712445 366..657 100 <- Minus
2L 3712498..3712862 1..365 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:15 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3712154..3712445 366..657 100 <- Minus
2L 3712498..3712862 1..365 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:48 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3712154..3712445 366..657 100 <- Minus
arm_2L 3712498..3712862 1..365 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:15 Download gff for GH27221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3712154..3712445 366..657 100 <- Minus
2L 3712498..3712862 1..365 100   Minus

GH27221.hyp Sequence

Translation from 2 to 541

> GH27221.hyp
FSRHQSSAEALRDKTSSIQIFFIEHTMEGDKVVFHSSDLPYEYLYDDEKH
VSHMPDSKLSVRNILDSAYASAEGKIITRKLSRSIPPYPHAVRVKNGIRV
YEYSEPRKQSYKSSLWKEAYNILHQRLDIAEPIAAKEHVRTQIHPCLHKI
KGLLDPETCIKCPRCHKSISSTKVVKSFA*

GH27221.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG31955-PD 153 CG31955-PD 1..153 27..179 810 100 Plus
CG31955-PC 153 CG31955-PC 1..153 27..179 810 100 Plus
CG31955-PA 153 CG31955-PA 1..153 27..179 810 100 Plus
CG31955-PB 63 CG31955-PB 2..63 118..179 312 95.2 Plus

GH27221.pep Sequence

Translation from 80 to 541

> GH27221.pep
MEGDKVVFHSSDLPYEYLYDDEKHVSHMPDSKLSVRNILDSAYASAEGKI
ITRKLSRSIPPYPHAVRVKNGIRVYEYSEPRKQSYKSSLWKEAYNILHQR
LDIAEPIAAKEHVRTQIHPCLHKIKGLLDPETCIKCPRCHKSISSTKVVK
SFA*

GH27221.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19681-PA 152 GF19681-PA 1..152 1..152 247 40.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24403-PA 152 GG24403-PA 1..152 1..153 494 62.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG31955-PD 153 CG31955-PD 1..153 1..153 810 100 Plus
CG31955-PC 153 CG31955-PC 1..153 1..153 810 100 Plus
CG31955-PA 153 CG31955-PA 1..153 1..153 810 100 Plus
CG31955-PB 63 CG31955-PB 2..63 92..153 312 95.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18120-PA 151 GM18120-PA 1..151 1..151 710 88.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22728-PA 152 GD22728-PA 1..151 1..151 695 86.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14797-PA 152 GE14797-PA 1..150 1..150 527 66.7 Plus