Clone GH27470 Report

Search the DGRC for GH27470

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:274
Well:70
Vector:pOT2
Associated Gene/TranscriptCG13623-RA
Protein status:GH27470.pep: gold
Preliminary Size:677
Sequenced Size:767

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13623 2002-01-01 Sim4 clustering to Release 2
CG13623 2002-05-18 Blastp of sequenced clone
CG13623 2003-01-01 Sim4 clustering to Release 3
CG13623 2008-04-29 Release 5.5 accounting
CG13623 2008-08-15 Release 5.9 accounting
CG13623 2008-12-18 5.12 accounting

Clone Sequence Records

GH27470.complete Sequence

767 bp (767 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118824

> GH27470.complete
AAATGATCGAAAAACTACGTGTTTTTTTTTAAATTATAAAATTTAATGAA
TGCAATTTGAAAGCTACATGACAATAAACTCAGTTTGAAAACGAAAACAT
CACAACAGCATGTACACAAGCCTAGATGGCCCAGTTGGGATGTATCGAAC
TATCGACACCTATCGTTATCGTGCGAAATCAGCTGAAATTGTTTGGATTA
CGAGATAGTAAATAGAAATATTGAAATTACATTTTTTGGCTGTGAAATCG
TAAAATTATGGCGTTCCTACTGCGACAAGTGGCCAGGAGCGGATTGCAAA
GAAATCTAATCCTAATGCGGCATGCAACCGCTTCCACATCCGCGAATCCC
GAACTTAGTGTCCAGGTGAGCGAGAGCTGCTTGAAACGGCTCCGTGAGAT
CTGCGTGGATGGATCTTTCCTGCGTGTGACCGTCGAAGGAGGCGGATGCT
CCGGCTTTCAGTACAAATTCGATTTGGATAAGCAGCTGAACGAGGATGAC
CGACAGTTTGGCGAGGCTGAGGCCAAGGTGGTGATCGATACAGTCTCGCT
GGAGTACTGCAGCGGCGCCACCGTGGACTACCATAGCGAACTAATACGCG
CCGGTTTCCGGATGGTGGCCAATCCGCTGGCGGAACAGGGCTGCTCCTGC
GGCTCCTCCTTCTCAATCAAATTGTAAACTTTAAACTTTAGAGAATTATT
TAATACACATAGAATGTTCAGTTATAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

GH27470.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13623-RA 796 CG13623-RA 1..726 1..726 3630 100 Plus
CG6607-RA 1617 CG6607-RA 1567..1617 726..676 255 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20353041..20353466 725..300 2040 98.6 Minus
chr3R 27901430 chr3R 20353526..20353826 301..1 1380 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:10:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24529772..24530198 726..300 2135 100 Minus
3R 32079331 3R 24530258..24530558 301..1 1505 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24270603..24271029 726..300 2135 100 Minus
3R 31820162 3R 24271089..24271389 301..1 1505 100 Minus
Blast to na_te.dros performed 2019-03-16 10:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy6 7826 gypsy6 GYPSY6 7826bp 6497..6545 8..56 119 71.4 Plus
P-element 2907 P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). 1943..2054 271..158 113 60 Minus
P-element 2907 P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). 2482..2553 184..258 107 62.7 Plus

GH27470.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:14:15 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20353041..20353464 302..725 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:58:51 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
CG13623-RA 1..420 258..677 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:45:43 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
CG13623-RA 1..420 258..677 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:57:44 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
CG13623-RA 1..420 258..677 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:02 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
CG13623-RA 1..420 258..677 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:00:34 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
CG13623-RA 1..420 258..677 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:21:08 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
CG13623-RA 1..723 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:45:43 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
CG13623-RA 1..725 1..725 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:57:44 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
CG13623-RA 1..725 1..725 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:03 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
CG13623-RA 1..723 1..723 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:00:34 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
CG13623-RA 1..725 1..725 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:15 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24529773..24530196 302..725 100 <- Minus
3R 24530258..24530558 1..301 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:15 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24529773..24530196 302..725 100 <- Minus
3R 24530258..24530558 1..301 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:15 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24529773..24530196 302..725 100 <- Minus
3R 24530258..24530558 1..301 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:57:44 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20355495..20355918 302..725 100 <- Minus
arm_3R 20355980..20356280 1..301 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:20 Download gff for GH27470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24270604..24271027 302..725 100 <- Minus
3R 24271089..24271389 1..301 100   Minus

GH27470.hyp Sequence

Translation from 257 to 676

> GH27470.hyp
MAFLLRQVARSGLQRNLILMRHATASTSANPELSVQVSESCLKRLREICV
DGSFLRVTVEGGGCSGFQYKFDLDKQLNEDDRQFGEAEAKVVIDTVSLEY
CSGATVDYHSELIRAGFRMVANPLAEQGCSCGSSFSIKL*

GH27470.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG13623-PB 139 CG13623-PB 1..139 1..139 707 100 Plus
CG13623-PA 139 CG13623-PA 1..139 1..139 707 100 Plus

GH27470.pep Sequence

Translation from 257 to 676

> GH27470.pep
MAFLLRQVARSGLQRNLILMRHATASTSANPELSVQVSESCLKRLREICV
DGSFLRVTVEGGGCSGFQYKFDLDKQLNEDDRQFGEAEAKVVIDTVSLEY
CSGATVDYHSELIRAGFRMVANPLAEQGCSCGSSFSIKL*

GH27470.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20708-PA 141 GF20708-PA 1..141 1..139 643 85.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12338-PA 139 GG12338-PA 1..139 1..139 714 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18782-PA 156 GH18782-PA 1..156 1..139 529 65.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13623-PB 139 CG13623-PB 1..139 1..139 707 100 Plus
CG13623-PA 139 CG13623-PA 1..139 1..139 707 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22674-PA 151 GI22674-PA 1..151 1..139 556 74.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21975-PA 140 GL21975-PA 1..140 1..139 595 78.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12415-PA 140 GA12415-PA 1..140 1..139 595 78.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23479-PA 139 GM23479-PA 1..139 1..139 724 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15084-PA 139 GD15084-PA 1..139 1..139 721 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23401-PA 147 GJ23401-PA 1..147 1..139 536 74.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22818-PA 141 GK22818-PA 1..141 1..139 552 75.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10792-PA 139 GE10792-PA 1..139 1..139 718 97.8 Plus