Clone GH27814 Report

Search the DGRC for GH27814

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:278
Well:14
Vector:pOT2
Associated Gene/TranscriptNC2alpha-RB
Protein status:GH27814.pep: wuzgold
Sequenced Size:1423

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10318 2002-11-11 Blastp of sequenced clone
CG10318 2003-01-01 Sim4 clustering to Release 3
NC2alpha 2008-04-29 Release 5.5 accounting
NC2alpha 2008-08-15 Release 5.9 accounting
NC2alpha 2008-12-18 5.12 accounting

Clone Sequence Records

GH27814.complete Sequence

1423 bp (1423 high quality bases) assembled on 2002-11-11

GenBank Submission: BT001451

> GH27814.complete
TTTTATTTCACTAGGACTCTTGACGATTACTTCACAAATCGGAAAATGCC
ATCGAAAAAGAAAAAATACAACGCACGCTTTCCGGCGGTAAGTTGAAACC
ACCGATTGGCGACAGGAAAGCTCCAGCCATTTGGCGGCCGTGAACGCCGA
AGATGGGTTATCAGTTTTCGTGCATGTGTACATACATATGTACATACACG
CCTCGCATAATCAGAGGCTCAAAAGAAGTAGAGGAGAAACCAAACCGGTG
CGAGATTATAATGTTTCCAAACCATTACCATAAACTCCTTGCAGGGTCGC
ATCAAGAAGATCATGCAAAGCGACGAGGAAATCGGGAAGGTGGCCCAGGC
GGTGCCTGTTATCATCTCACGCACGCTGGAGCTCTTCGTGGAGTCGCTGC
TGACCAAGACGCTGCGCATCACGAATGCGCGCAACGCCAAGACGCTATCG
CCATCGCACATGAGGCAGTGTATCGTATCCGAGAAACGCTTTGACTTCCT
CAAGGAGCTGGTCCGCAACATACCCGACATCAGTGTGGCCGAGGAGGCCG
CCTACAACGAGGACGATGTGTTACGCAGCTCGCCAGAGGAACAGTATCCA
GATTCAGACACGCCATATGATCTTAGCCTGCCATCGACGTCAATGCGCTC
GCAGGCGAACGGCACAGCTGCCTACATGCGCTCCATGAGTCTGAACAACG
GAGCCGGATCGGGCGGAGGAGCCGCAGCCACCAAGCGGCAGTTTCAGTCG
CAGCACTCCACCCAGGAAACTCCCACCACCAGCACCACCCTGCCCGCCAA
GCTGGCCCGCTCCGGGTCCATGCCGGCCTACACGCCACGGGGCAGACCGC
CCAATCACCTCAAGAAACAGTCGGTGCAGCTCGATACTGCCATACCCGCC
CCGATCTGCAACTACGAACTCAACAAGCCCATTGTCAAGATCGACTACAG
CCACGTGCAAATGCCGACGGCGAACCTGTGCACACCGGACGCCTCTGATT
CTGGGTCAGGATCGGGCGCCGGATCTGGAGCTTTTAACTTCGACATAGCT
GCTCCGGTGATCAATATCGATCTGACGAATATCGTGGCCGGTGGAGCACC
TGGCAGTGGTGTGCCCCCCGCCTCTATTGGATTACCAGCGGCCACGCCGG
GGGACAACAATAATGTGAACCAAATGGCTGGAAAGAGCAGCGCTCCCATC
ATTCCAAAGGCCACAGCGGCATCAGCGACCCCCACTGAAACCGTTTTCGA
ATTAGACGAAGACTATGACAATATTTGATTAGGATCTATGTGAATGCGCT
TTTAAATTATTGATACATTAATATGTACTCTAGGTCTAAGAAATCACAAT
AACATTTTTTGCAAAATAAAGACCATGCTGGATTTTAAGCTGAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

GH27814.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
NC2alpha-RB 1392 NC2alpha-RB 1..1392 1..1392 6960 100 Plus
NC2alpha-RA 1371 NC2alpha-RA 212..1311 294..1393 5500 100 Plus
NC2alpha-RA 1371 NC2alpha-RA 126..213 1..88 440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17556652..17558043 1..1392 6915 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:11:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21670202..21671594 1..1393 6965 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21671401..21672793 1..1393 6965 100 Plus
Blast to na_te.dros performed 2019-03-15 15:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 434..499 143..209 116 67.6 Plus

GH27814.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:47:00 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17556652..17558043 1..1392 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:59:15 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
NC2alpha-RA 36..1026 286..1278 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:05:49 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
NC2alpha-RA 36..1026 286..1278 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:39:53 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
NC2alpha-RA 36..1026 286..1278 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:44 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
NC2alpha-RA 36..1026 286..1278 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:15:27 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
NC2alpha-RA 36..1026 286..1278 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:25:16 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
NC2alpha-RB 1..1392 1..1392 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:05:49 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
NC2alpha-RB 1..1392 1..1392 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:39:53 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
NC2alpha-RA 131..1235 286..1392 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:44 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
NC2alpha-RB 1..1392 1..1392 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:15:27 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
NC2alpha-RA 131..1235 286..1392 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:47:00 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21670202..21671593 1..1392 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:47:00 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21670202..21671593 1..1392 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:47:00 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21670202..21671593 1..1392 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:39:53 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17557707..17559098 1..1392 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:28:08 Download gff for GH27814.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21671401..21672792 1..1392 100   Plus

GH27814.hyp Sequence

Translation from 312 to 1277

> GH27814.hyp
MQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNARNAKTLSPSHM
RQCIVSEKRFDFLKELVRNIPDISVAEEAAYNEDDVLRSSPEEQYPDSDT
PYDLSLPSTSMRSQANGTAAYMRSMSLNNGAGSGGGAAATKRQFQSQHST
QETPTTSTTLPAKLARSGSMPAYTPRGRPPNHLKKQSVQLDTAIPAPICN
YELNKPIVKIDYSHVQMPTANLCTPDASDSGSGSGAGSGAFNFDIAAPVI
NIDLTNIVAGGAPGSGVPPASIGLPAATPGDNNNVNQMAGKSSAPIIPKA
TAASATPTETVFELDEDYDNI*

GH27814.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
NC2alpha-PA 341 CG10318-PA 21..341 1..321 1638 100 Plus

GH27814.pep Sequence

Translation from 312 to 1277

> GH27814.pep
MQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNARNAKTLSPSHM
RQCIVSEKRFDFLKELVRNIPDISVAEEAAYNEDDVLRSSPEEQYPDSDT
PYDLSLPSTSMRSQANGTAAYMRSMSLNNGAGSGGGAAATKRQFQSQHST
QETPTTSTTLPAKLARSGSMPAYTPRGRPPNHLKKQSVQLDTAIPAPICN
YELNKPIVKIDYSHVQMPTANLCTPDASDSGSGSGAGSGAFNFDIAAPVI
NIDLTNIVAGGAPGSGVPPASIGLPAATPGDNNNVNQMAGKSSAPIIPKA
TAASATPTETVFELDEDYDNI*

GH27814.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13258-PA 347 GF13258-PA 21..347 1..321 1113 76.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22128-PA 342 GG22128-PA 21..342 1..321 1408 92.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22636-PA 357 GH22636-PA 21..357 1..321 926 61.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
NC2alpha-PA 341 CG10318-PA 21..341 1..321 1638 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18330-PA 351 GI18330-PA 21..351 1..321 872 59.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10800-PA 316 GL10800-PA 21..316 1..321 985 65.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10241-PA 316 GA10241-PA 21..316 1..321 985 65.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15852-PA 336 GM15852-PA 21..336 1..321 1377 94.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11613-PA 343 GD11613-PA 21..343 1..321 1630 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19756-PA 350 GJ19756-PA 21..350 1..321 931 61.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10735-PA 375 GK10735-PA 21..375 1..321 895 60.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12211-PA 342 GE12211-PA 21..342 1..321 1451 94.7 Plus